TkA07G264390 | RubberDandelionOmics

Gene overview

TkA07G264390

Reference: TK1151 Chr: Chr07 Coordinates: 66093097-66093702 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA07G264390|TK1151|cDNA

ATGATTTCTGAAAGACAAGATGAGAAAGCTTTTTATCTCGATCCTCATGGAGTCCAACAGGTGGTTAATATAAGCAAGGACAATCTGGAGGCCGATACTTCTTCATATCATTGCAATGTTGTAAGACAAATTCCACTTGAACCCATTGATCCATCTCTAGCCATTGGATTCTATTGCCGGGACAAAGATGATTTTGAAGATTTTTGTTCGCGGGCATCGGAATTAGCAACGGAATCAAACGGTGCACCGCTGTTCACAGT...

CDS

Download CDS FASTA

387 bp · TkA07G264390|TK1151|CDS

ATGATTTCTGAAAGACAAGATGAGAAAGCTTTTTATCTCGATCCTCATGGAGTCCAACAGGTGGTTAATATAAGCAAGGACAATCTGGAGGCCGATACTTCTTCATATCATTGCAATGTTGTAAGACAAATTCCACTTGAACCCATTGATCCATCTCTAGCCATTGGATTCTATTGCCGGGACAAAGATGATTTTGAAGATTTTTGTTCGCGGGCATCGGAATTAGCAACGGAATCAAACGGTGCACCGCTGTTCACAGT...

Protein

Download Protein FASTA

128 aa · TkA07G264390|TK1151|PROTEIN

MISERQDEKAFYLDPHGVQQVVNISKDNLEADTSSYHCNVVRQIPLEPIDPSLAIGFYCRDKDDFEDFCSRASELATESNGAPLFTVTQTRHLARPSGASRAGEEDGADSFDGVDDAEGSAQDDWQLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G264390`
TK1151 ID	TkA07G264390
OH-1004 ID	LXL04_020446
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.112 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G264390

Location Chr07:66093097-66093702 (+)

Description Similar to ATG4: Cysteine protease ATG4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44140`	Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.	No verified direct reference in this release
`At3g59950`	Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0391000`	Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.	No verified direct reference in this release
`UniProt: A2XHJ5`	Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020446 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000423 mitophagy Biological Process

GO:0006508 proteolysis Biological Process

GO:0006914 autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0016485 protein processing Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0035973 aggrephagy Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004197 cysteine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G44140

dosa:Os03g0391000

dosa:Os04g0682000

mtr:11436743

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.485

Rank 1 · TkA07G264390 · TK1151

Cytoplasm0.476

Rank 2 · TkA07G264390 · TK1151

Cell membrane0.087

Rank 3 · TkA07G264390 · TK1151

Mitochondrion0.084

Rank 4 · TkA07G264390 · TK1151

Endoplasmic reticulum0.067

Rank 5 · TkA07G264390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03416Peptidase_C545-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G264390	`PF03416`	Peptidase_C54	5	71	2.7e-20	73.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S929`	Arabidopsis thaliana	sp\|Q8S929\|ATG4A_ARATH Cysteine protease ATG4a	58.500%	Swiss-Prot	High
`Q9M1Y0`	Arabidopsis thaliana	sp\|Q9M1Y0\|ATG4B_ARATH Cysteine protease ATG4b	53.700%	Swiss-Prot	High
`Q75KP8`	Oryza sativa subsp. japonica	sp\|Q75KP8\|ATG4A_ORYSJ Cysteine protease ATG4A	56.000%	Swiss-Prot	High
`A2XHJ5`	Oryza sativa subsp. indica	sp\|A2XHJ5\|ATG4A_ORYSI Cysteine protease ATG4A	55.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card