RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G261030
Reference: TK1151 Chr: Chr07 Coordinates: 65264704-65266680 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1941 bp · TkA07G261030|TK1151|cDNA

ATGGAAGCAGATTCAACAGAAGATGGCGCATTCCCACCTCCAAAGATTTACCTTTCGAGTTCCTTACCAGGTTCTTTTGTACCCATTAGAGCTCCCCTTACTATTGATTCAGATTCCGAGTTCGGTTTATCCAATAACGACCAAATTTGCTCCAGAACTAGCAGCTTTAATAGCACTAGCAGTATTGATATCAGTAGTTACGGCGATGAGCATACTAGTGTTCATGAAGAAGAAGATGACGCTTTTCTAGCATACACAGA...

CDS

Download CDS FASTA

1941 bp · TkA07G261030|TK1151|CDS

ATGGAAGCAGATTCAACAGAAGATGGCGCATTCCCACCTCCAAAGATTTACCTTTCGAGTTCCTTACCAGGTTCTTTTGTACCCATTAGAGCTCCCCTTACTATTGATTCAGATTCCGAGTTCGGTTTATCCAATAACGACCAAATTTGCTCCAGAACTAGCAGCTTTAATAGCACTAGCAGTATTGATATCAGTAGTTACGGCGATGAGCATACTAGTGTTCATGAAGAAGAAGATGACGCTTTTCTAGCATACACAGA...

Protein

Download Protein FASTA

646 aa · TkA07G261030|TK1151|PROTEIN

MEADSTEDGAFPPPKIYLSSSLPGSFVPIRAPLTIDSDSEFGLSNNDQICSRTSSFNSTSSIDISSYGDEHTSVHEEEDDAFLAYTDQEILIETCRVKEYSCTTPFVKYPDGNSVKVRSNFDESAIYIPALKTPCEESSSVADFRIKSGVPVAPLTSDCDSDIDSVEDHRWLHSVDFPADGIVQKFNMSPKVRTLSGDEGEDEVDKESQFEGTFSDDSINSIDELSASMKNSVIAESIDDEEHKVDCLNVAELQRIDAEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G261030
TK1151 IDTkA07G261030
OH-1004 IDLXL04_037059
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)36.900
Protein coverage (%)TK1151 33.282 / OH-1004 18.722
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G261030
LocationChr07:65264704-65266680 (+)
DescriptionSimilar to TOC159: Translocase of chloroplast 159, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g02510 GTPase involved in protein precursor import into chloroplasts.
The major protein import receptor of plastids is essential for chloroplast biogenesis.2000 · DOI: 10.1038/35003214
Dimerization of Toc-GTPases at the chloroplast protein import machinery.2003 · DOI: 10.1074/jbc.m305946200
The roles of toc34 and toc75 in targeting the toc159 preprotein receptor to chloroplasts.2003 · DOI: 10.1074/jbc.m307873200
Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309
AtToc90, a new GTP-binding component of the Arabidopsis chloroplast protein import machinery.2004 · DOI: 10.1023/b:plan.0000036374.92546.51
Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
At5g20300 GTPase involved in protein precursor import into chloroplasts.
AtToc90, a new GTP-binding component of the Arabidopsis chloroplast protein import machinery.2004 · DOI: 10.1023/b:plan.0000036374.92546.51

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037059 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0045036 protein targeting to chloroplast Biological Process
GO:0045037 protein import into chloroplast stroma Biological Process
GO:0005634 nucleus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0009707 chloroplast outer membrane Cellular Component
GO:0009941 chloroplast envelope Cellular Component
GO:0061927 TOC-TIC supercomplex I Cellular Component
GO:0003924 GTPase activity Molecular Function
GO:0004888 transmembrane signaling receptor activity Molecular Function
GO:0004930 G protein-coupled receptor activity Molecular Function
KEGG gene cross-reference
ath:AT2G16640
ath:AT3G16620
ath:AT4G02510
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385
Rank 1 · TkA07G261030 · TK1151
Nucleus0.294
Rank 2 · TkA07G261030 · TK1151
Cell membrane0.269
Rank 3 · TkA07G261030 · TK1151
Endoplasmic reticulum0.094
Rank 4 · TkA07G261030 · TK1151
Golgi apparatus0.083
Rank 5 · TkA07G261030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18667BppU_IgG36-84 aa
PF18667BppU_IgG107-118 aa
PF13177DNA_pol3_delta2223-294 aa
PF07466DUF1517231-278 aa
PF01948PyrI232-282 aa
PF00735Septin244-289 aa
PF18667BppU_IgG251-287 aa
PF13177DNA_pol3_delta2300-333 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G261030PF18667BppU_IgG36840.01515.9
TkA07G261030PF18667BppU_IgG1071180.01515.9
TkA07G261030PF13177DNA_pol3_delta22232940.002718.4
TkA07G261030PF07466DUF15172312780.5211.0
TkA07G261030PF01948PyrI2322820.212.6
TkA07G261030PF00735Septin2442890.1412.1
TkA07G261030PF18667BppU_IgG2512870.01515.9
TkA07G261030PF13177DNA_pol3_delta23003330.002718.4
TkA07G261030PF01948PyrI3103620.212.6
TkA07G261030PF07466DUF15173113560.5211.0
TkA07G261030PF00735Septin3243630.1412.1
TkA07G261030PF13177DNA_pol3_delta23283670.002718.4
TkA07G261030PF18667BppU_IgG3343660.01515.9
TkA07G261030PF12775AAA_74064360.1112.8
TkA07G261030PF16796Microtub_bd4124370.02415.3
TkA07G261030PF03193RsgA_GTPase4144740.1912.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O81283Arabidopsis thalianasp|O81283|TC159_ARATH Translocase of chloroplast 159, chloroplastic38.600%Swiss-ProtLow
Q6S5G3Arabidopsis thalianasp|Q6S5G3|TOC90_ARATH Translocase of chloroplast 90, chloroplastic41.900%Swiss-ProtLow

JBrowse

View in Genome Browser