RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G260430
Reference: TK1151 Chr: Chr07 Coordinates: 65118632-65119225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

373 bp · TkA07G260430|TK1151|cDNA

CCCCACTTTCATGCACCCAGTTTCTCTAGCAAATTCATGCATACGGAGCTTCACGCACTATATGGGTCTCGACCTCTGGTCGCCAGCCGGGAGAAAATCAGCCACGAGTGCTCCAGCCAGGAGTCGAACTCCTGACCTTCACCCACATGAGGCCTATAAACCCGGTGCCTCTTCCCAGCTGAGCTGGGGGGTCATTGGCTGGGTCCTAGTATCAACTATGGCAAGAGTAGTAAAGAGAACATTCAGCCTGTCCCAAGAAC...

CDS

Download CDS FASTA

363 bp · TkA07G260430|TK1151|CDS

ATGCACCCAGTTTCTCTAGCAAATTCATGCATACGGAGCTTCACGCACTATATGGGTCTCGACCTCTGGTCGCCAGCCGGGAGAAAATCAGCCACGAGTGCTCCAGCCAGGAGTCGAACTCCTGACCTTCACCCACATGAGGCCTATAAACCCGGTGCCTCTTCCCAGCTGAGCTGGGGGGTCATTGGCTGGGTCCTAGTATCAACTATGGCAAGAGTAGTAAAGAGAACATTCAGCCTGTCCCAAGAACATGACAACCT...

Protein

Download Protein FASTA

121 aa · TkA07G260430|TK1151|PROTEIN

MHPVSLANSCIRSFTHYMGLDLWSPAGRKSATSAPARSRTPDLHPHEAYKPGASSQLSWGVIGWVLVSTMARVVKRTFSLSQEHDNLKALEPSPVNITMSFVCKNCNKSLKVNMEEVTVTD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G260430
TK1151 IDTkA07G260430
OH-1004 IDLXL04_026500
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)91.700
Protein coverage (%)TK1151 49.587 / OH-1004 12.632
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G260430
LocationChr07:65118632-65119225 (-)
DescriptionSimilar to CPSF30: 30-kDa cleavage and polyadenylation specificity factor 30
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026500 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process
GO:0000398 mRNA splicing, via spliceosome Biological Process
GO:0006376 mRNA splice site recognition Biological Process
GO:0006396 RNA processing Biological Process
GO:0006406 mRNA export from nucleus Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007283 spermatogenesis Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0010608 post-transcriptional regulation of gene expression Biological Process
GO:0031124 mRNA 3'-end processing Biological Process
GO:0031440 regulation of mRNA 3'-end processing Biological Process
GO:0034052 positive regulation of plant-type hypersensitive response Biological Process
KEGG gene cross-reference
ath:AT1G30460
dosa:Os06g0677700
hsa:91746
mmu:231386
rno:170956
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.394
Rank 1 · TkA07G260430 · TK1151
Nucleus0.380
Rank 2 · TkA07G260430 · TK1151
Mitochondrion0.226
Rank 3 · TkA07G260430 · TK1151
Cell membrane0.107
Rank 4 · TkA07G260430 · TK1151
Endoplasmic reticulum0.074
Rank 5 · TkA07G260430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser