TkA07G259400 | RubberDandelionOmics

Gene overview

TkA07G259400

Reference: TK1151 Chr: Chr07 Coordinates: 64849152-64856005 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3695 bp · TkA07G259400|TK1151|cDNA

ACCATTTTGGTAAATATGTTTTATTAACACCCTTTGAGTCAAAAACTCGTTTAAAGATACCGAGACATGGCCAGCTCTGCCATTCCTTTTTTCGCTTATCCAAACAAAGGAGCCCTTACTTCTTTCTTTCTTTCTTCGATAATGGAAGCTCACAAGTTTTTCAAATGAACCCAAACATGAAGAGCCATTAGCAGCCTCCGATCCCACCAACAAAACTATCCACCATGGCAACGCAAACTTCTCATACCGTTCTGTCATTG...

CDS

Download CDS FASTA

3222 bp · TkA07G259400|TK1151|CDS

ATGGCAACGCAAACTTCTCATACCGTTCTGTCATTGAGAGGTTGCTCGCCATTTACAAAATCATCTTCGTTTGGACTGATTGATTTCAGGAGATGTTCTTCTTCCATTGAGCTCTCATCTCTCTTCAATTTTACATATTGTTATATTTATCCTAGAAATGCTTATTGTACTTATTCAAAGCGAAGGTCTCGTGGGCCCGTTATGGCTGCCAAAAAAGAATCTAAAGGAACAAAGCAAGGAGATGGAAAATACAAACATAC...

Protein

Download Protein FASTA

1073 aa · TkA07G259400|TK1151|PROTEIN

MATQTSHTVLSLRGCSPFTKSSSFGLIDFRRCSSSIELSSLFNFTYCYIYPRNAYCTYSKRRSRGPVMAAKKESKGTKQGDGKYKHTVDLPKTSFGMRANSSVREPEIQKLWDENQVFKKVSEKNNGGSFILHDGPPYANGDLHMGHALNKIIKDIINRYKLLQNCKVHYIPGWDCHGLPIELKVLQSLDQDARKGLTPIKLRAKAAKFAKATVKAQMASFKRFGVWADWDHPYLTLDPEYEAAQIEVFGQMVFKGYIYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G259400`
TK1151 ID	TkA07G259400
OH-1004 ID	LXL04_028991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G259400

Location Chr07:64849152-64856005 (-)

Description Similar to OVA2: Isoleucine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49030`	Isoleucine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028991 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006428 isoleucyl-tRNA aminoacylation Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004822 isoleucine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ana:alr1073

ath:AT5G49030

cyn:Cyan7425_3114

cyp:PCC8801_2707

npu:Npun_F1478

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.905

Rank 1 · TkA07G259400 · TK1151

Mitochondrion0.169

Rank 2 · TkA07G259400 · TK1151

Cytoplasm0.056

Rank 3 · TkA07G259400 · TK1151

Peroxisome0.030

Rank 4 · TkA07G259400 · TK1151

Nucleus0.021

Rank 5 · TkA07G259400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133tRNA-synt_1108-751 aa

PF09334tRNA-synt_1g137-281 aa

PF01406tRNA-synt_1e141-172 aa

PF13603tRNA-synt_1_2406-465 aa

PF09334tRNA-synt_1g508-577 aa

PF01406tRNA-synt_1e678-722 aa

PF09334tRNA-synt_1g690-722 aa

PF08264Anticodon_1797-960 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G259400	`PF00133`	tRNA-synt_1	108	751	5.9e-132	441.1
TkA07G259400	`PF09334`	tRNA-synt_1g	137	281	8.6e-22	78.1
TkA07G259400	`PF01406`	tRNA-synt_1e	141	172	0.0042	17.2
TkA07G259400	`PF13603`	tRNA-synt_1_2	406	465	1.2e-06	28.9
TkA07G259400	`PF09334`	tRNA-synt_1g	508	577	8.6e-22	78.1
TkA07G259400	`PF01406`	tRNA-synt_1e	678	722	0.0042	17.2
TkA07G259400	`PF09334`	tRNA-synt_1g	690	722	8.6e-22	78.1
TkA07G259400	`PF08264`	Anticodon_1	797	960	9.3e-30	104.2
TkA07G259400	`PF06827`	zf-FPG_IleRS	1031	1057	7.2e-06	26.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXK8`	Arabidopsis thaliana	sp\|Q8RXK8\|SYIM_ARATH Isoleucine--tRNA ligase, chloroplastic/mitochondrial	73.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card