TkA07G258820 | RubberDandelionOmics

Gene overview

TkA07G258820

Reference: TK1151 Chr: Chr07 Coordinates: 64702007-64705187 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1127 bp · TkA07G258820|TK1151|cDNA

TTTGAAATGACCACCACCGTTTAAAATCCCAACATCAACCTATATGTGTGACTGTGTGTTCAATCAAGCTTCTGGTGCCAATGGATGATAAGCTACCATCTACAACTGCAACCATCCTTCAATACTATCATGACATGTCCAAGCTTCATACCGATGCGACCCTGCTCTATTCCTTTCTGGATGACGATGGCAGACATGCGTTGATATTGGATTCCACTATTTTTCACCCACAAGGTGGTGGGCAGCCATCCGACACCGGT...

CDS

Download CDS FASTA

777 bp · TkA07G258820|TK1151|CDS

ATGGATGATAAGCTACCATCTACAACTGCAACCATCCTTCAATACTATCATGACATGTCCAAGCTTCATACCGATGCGACCCTGCTCTATTCCTTTCTGGATGACGATGGCAGACATGCGTTGATATTGGATTCCACTATTTTTCACCCACAAGGTGGTGGGCAGCCATCCGACACCGGTTTCATAACCGATGTCTCCTCTTCTGGCTTCAAATTCGTCGTTCAAGATGTCCGATCCAAGAATGGCATTGTTTATCATTA...

Protein

Download Protein FASTA

258 aa · TkA07G258820|TK1151|PROTEIN

MDDKLPSTTATILQYYHDMSKLHTDATLLYSFLDDDGRHALILDSTIFHPQGGGQPSDTGFITDVSSSGFKFVVQDVRSKNGIVYHYGVFEKTAEDLKGGAQVLLSVDESRRKLNSRLHSAGHLLDICMGQVGLRHLEPGKGYHFPDGPYVEYKGTVPQAELQNKQKELQFEANNLISSGGKVSVSLYPYEEAAMLCGGALPDYIPKGSTPRIVKLGDFPGCPCGGTHVSNISELVNMKVTQMRTKKGLTKVYYNIGD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G258820`
TK1151 ID	TkA07G258820
OH-1004 ID	LXL04_028985
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G258820`
Location	Chr07:64702007-64705187 (-)
Description	Similar to alaXL: Alanyl-tRNA editing protein AlaX-L (Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028985` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006419 alanyl-tRNA aminoacylation Biological Process GO:0005737 cytoplasm Cellular Component GO:0000049 tRNA binding Molecular Function GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function GO:0003676 nucleic acid binding Molecular Function GO:0004813 alanine-tRNA ligase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	mac:MA_0194 mba:Mbar_A2092 mma:MM_1486 mtp:Mthe_0657 pho:PH1969 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.778

Rank 1 · TkA07G258820 · TK1151

Nucleus0.431

Rank 2 · TkA07G258820 · TK1151

Mitochondrion0.089

Rank 3 · TkA07G258820 · TK1151

Peroxisome0.055

Rank 4 · TkA07G258820 · TK1151

Cell membrane0.044

Rank 5 · TkA07G258820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01411tRNA-synt_2c37-110 aa

PF07973tRNA_SAD123-130 aa

PF07973tRNA_SAD195-199 aa

PF07973tRNA_SAD212-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G258820	`PF01411`	tRNA-synt_2c	37	110	1.3e-10	41.1
TkA07G258820	`PF07973`	tRNA_SAD	123	130	7.5e-07	29.7
TkA07G258820	`PF07973`	tRNA_SAD	195	199	7.5e-07	29.7
TkA07G258820	`PF07973`	tRNA_SAD	212	250	7.5e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card