Gene Card
Gene overview
cDNA / CDS / Protein Sequences
315 bp · TkA07G258530|TK1151|cDNA
TTGGTACCTTTTTTTTGGAACCGGCGGTTGTTGCAACGGAAAGCCACATCTCCCATTATTTCAGAGAGGGTCCCGAGTTCGAGACATCCCGAGGGGCAGTTCGAACCCATAGGAGTTCCAGGGAGAAATTTCACCACACCAGAGCTTCGCGCGAAGGATTTACCCGAGCATAGGACTACTCGGCACCCCCACACCCGATGGGTTATTAAAACCCGATGCATCGCGCTTGCCAAGGATCGAACACTGGACCTCCCAAAGGG...
315 bp · TkA07G258530|TK1151|CDS
TTGGTACCTTTTTTTTGGAACCGGCGGTTGTTGCAACGGAAAGCCACATCTCCCATTATTTCAGAGAGGGTCCCGAGTTCGAGACATCCCGAGGGGCAGTTCGAACCCATAGGAGTTCCAGGGAGAAATTTCACCACACCAGAGCTTCGCGCGAAGGATTTACCCGAGCATAGGACTACTCGGCACCCCCACACCCGATGGGTTATTAAAACCCGATGCATCGCGCTTGCCAAGGATCGAACACTGGACCTCCCAAAGGG...
Protein
Download Protein FASTA104 aa · TkA07G258530|TK1151|PROTEIN
LVPFFWNRRLLQRKATSPIISERVPSSRHPEGQFEPIGVPGRNFTTPELRAKDLPEHRTTRHPHTRWVIKTRCIALAKDRTLDLPKGDQLTYRLDKRSLAQFGT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G258530 |
|---|---|
| TK1151 ID | TkA07G258530 |
| OH-1004 ID | LXL04_007473 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 58.100 |
| Protein coverage (%) | TK1151 81.731 / OH-1004 11.822Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G258530 |
|---|---|
| Location | Chr07:64651591-64651905 (+) |
| Description | Similar to BON3: Protein BONZAI 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006508 proteolysis Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006952 defense response Biological Process GO:0009266 response to temperature stimulus Biological Process GO:0009270 response to humidity Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0019725 cellular homeostasis Biological Process GO:0030335 positive regulation of cell migration Biological Process GO:0038128 ERBB2 signaling pathway Biological Process GO:0043069 negative regulation of programmed cell death Biological Process |
| KEGG gene cross-reference | ath:AT1G08860 ath:AT5G07300 ath:AT5G61900 hsa:8895 hsa:8904 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.