TkA07G258020 | RubberDandelionOmics

Gene overview

TkA07G258020

Reference: TK1151 Chr: Chr07 Coordinates: 64541225-64544896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2200 bp · TkA07G258020|TK1151|cDNA

AATGTTGTTACACATTCAAGAAACAAACAAAATTTACTGTAGATAGATGTGATCTAATCCAATTGTTATTAAAAAAATGAAACAATCTTGCCTCTTGGCAGTCGGGAAAGATGAAAAAACTCAAGTGGGTTTGGAGGGGACCCATTCGCCTTTATTTTGGGTGGTCTAAACAAATTCACCGGTTTTCCTGAATCACCCATAGTCACAGTTGACCTTCTCTTTCCGTATCCTCCTCCATCGTCACCCGCCATACTCTACTA...

CDS

Download CDS FASTA

1500 bp · TkA07G258020|TK1151|CDS

ATGTCCAAATATATTGAAATGATGCATGAAAAGTCAATTCTTGATCCCGGTGGAGAAATGGAAGTGAGTTTCGAATATCAATGTAACACCACCGACGGATACGAAATACCCACCGGAAAAAAACTCGTAAGAAACAACAGTTCTTTCACTTGCCTCTCGGGGGCCGCCATTAGCGCAAACGCAACTTTAGCAAACACAAACATCTGCAACGGATTAATCAGCTCCGAAATCCTCCCATCAATCGATTCCCCCAAATCATT...

Protein

Download Protein FASTA

499 aa · TkA07G258020|TK1151|PROTEIN

MSKYIEMMHEKSILDPGGEMEVSFEYQCNTTDGYEIPTGKKLVRNNSSFTCLSGAAISANATLANTNICNGLISSEILPSIDSPKSFRRIFPIFPKLDLLSSSFQSNMSNLSCSPSTPEHLDFDSFLSKPLSLPSRSEEFLNAIEVQVAGGAAGEDRVQAVCSEENGWLFCAIYDGFNGRDAADFLAGTFYETIRFNLNSLDIDYSNGFTNGFDDYFLGDGDMAVVSKRPKNQVLESLQRALNQAENDFLYMVEQEMEDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G258020`
TK1151 ID	TkA07G258020
OH-1004 ID	LXL04_000592
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.900
Protein coverage (%)	TK1151 70.341 / OH-1004 64.460 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G258020

Location Chr07:64541225-64544896 (-)

Description Similar to PLL4: Probable protein phosphatase 2C 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16560`	Probable protein phosphatase 2C 40.	No verified direct reference in this release
`At1g07630`	Involved in leaf development regulation.	POL and related phosphatases are dosage-sensitive regulators of meristem and organ development in Arabidopsis.2005 · DOI: 10.1016/j.ydbio.2005.06.020
`At2g28890`	Involved in leaf development regulation.	POL and related phosphatases are dosage-sensitive regulators of meristem and organ development in Arabidopsis.2005 · DOI: 10.1016/j.ydbio.2005.06.020

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0403701`	Probable protein phosphatase 2C 39.	No verified direct reference in this release
`Os03g0821300`	Protein phosphatase that acts on XA21 pathogen recognition receptor.	Rice XB15, a protein phosphatase 2C, negatively regulates cell death and XA21-mediated innate immunity.2008 · DOI: 10.1371/journal.pbio.0060231

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000592 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048366 leaf development Biological Process

GO:0048827 phyllome development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G07630

ath:AT2G28890

ath:AT3G09400

ath:AT5G02400

dosa:Os03g0821300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.389

Rank 1 · TkA07G258020 · TK1151

Cytoplasm0.381

Rank 2 · TkA07G258020 · TK1151

Cell membrane0.167

Rank 3 · TkA07G258020 · TK1151

Plastid0.072

Rank 4 · TkA07G258020 · TK1151

Lysosome / Vacuole0.071

Rank 5 · TkA07G258020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13672PP2C_2151-299 aa

PF00481PP2C227-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G258020	`PF13672`	PP2C_2	151	299	0.0016	18.8
TkA07G258020	`PF00481`	PP2C	227	428	3.5e-33	116.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUS8`	Arabidopsis thaliana	sp\|Q9LUS8\|P2C40_ARATH Probable protein phosphatase 2C 40	61.400%	Swiss-Prot	High
`Q9LQN6`	Arabidopsis thaliana	sp\|Q9LQN6\|P2C04_ARATH Probable protein phosphatase 2C 4	37.800%	Swiss-Prot	Medium
`Q9ZV25`	Arabidopsis thaliana	sp\|Q9ZV25\|P2C23_ARATH Probable protein phosphatase 2C 23	36.900%	Swiss-Prot	Medium
`Q7XVF9`	Oryza sativa subsp. japonica	sp\|Q7XVF9\|P2C39_ORYSJ Probable protein phosphatase 2C 39	53.600%	Swiss-Prot	High
`Q84T94`	Oryza sativa subsp. japonica	sp\|Q84T94\|P2C35_ORYSJ Protein phosphatase 2C 35	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card