TkA07G256090 | RubberDandelionOmics

Gene overview

TkA07G256090

Reference: TK1151 Chr: Chr07 Coordinates: 64040115-64043942 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2676 bp · TkA07G256090|TK1151|cDNA

ATTTACTTTCTATGTTTATGGGCGAATAATGTAACCGCATCCGATATTTACCAAACATAATCGGTAAGACTTTTACGACGTCGCTGTTATTATTTATTTTCTAGTCTGTTTTTTCTTTTGGGTTTGGCAATGCAGCCATTCCATGATTATCGGAAGAAATCTCAAGAGCTTATTCGATCATAAGAAGGAAACCTCTAATTTCATAATTCGTATCGAATTCGATCACCAGTAAACTACAAGTTATAGGGTGTGCTGTTTCT...

CDS

Download CDS FASTA

2091 bp · TkA07G256090|TK1151|CDS

ATGCATGAATATAATTCGCTGGATCTCAATCGGTATCTTCAGTTCGGCATCACAGCTTTCGCTGTTCTCTTTGGATTGATTTTGCTAGTGAAGAACACTGCTTCCAAGTACTTCGTTGTTGACGGAGACGACGACGCCCGGTTCGATTCTCATCCTCAATCTTCTTCTCCCGCCGCTCCATCCGACTCCGGTGTATCCCCCTCGTCGTCGTCGATGCCGGGTATTGTTGCAACTAGTGATTTATGCGTTGTATGCGGTAG...

Protein

Download Protein FASTA

696 aa · TkA07G256090|TK1151|PROTEIN

MHEYNSLDLNRYLQFGITAFAVLFGLILLVKNTASKYFVVDGDDDARFDSHPQSSSPAAPSDSGVSPSSSSMPGIVATSDLCVVCGSLTKKHCSRCKGVRYCSESCQRSHWFSGHKEKCEEIRLSCKSSLQGRRNPTAAALVTGNGTSSQTKKILFPYEEFVDLFNWKKQGFPPCGLLNCGNSCFANVVLQCLAYTRPLAAYLLTKGHRRECRRNEWCFLCELQAHVERASQSNHAFSPINILSRLPNIGGNLGYGKQED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G256090`
TK1151 ID	TkA07G256090
OH-1004 ID	LXL04_039137
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.100
Protein coverage (%)	TK1151 50.718 / OH-1004 42.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G256090

Location Chr07:64040115-64043942 (-)

Description Similar to UBP17: Ubiquitin carboxyl-terminal hydrolase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31670`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At2g24640`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At1g17110`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	Functional characterization of the Arabidopsis ubiquitin-specific protease gene family reveals specific role and redundancy of individual members in development.2008 · DOI: 10.1111/j.1365-313x.2008.03557.x The ubiquitin receptor DA1 regulates seed and organ size by modulating the stability of the ubiquitin-specific protease UBP15/SOD2 in Arabidopsis.2014 · DOI: 10.1105/tpc.114.122663
`At5g65450`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0244300`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	Ubiquitin Specific Protease 15 Has an Important Role in Regulating Grain Width and Size in Rice.2019 · DOI: 10.1104/pp.19.00065

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009908 flower development Biological Process

GO:0010154 fruit development Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0048367 shoot system development Biological Process

GO:0051301 cell division Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G17110

ath:AT2G24640

ath:AT4G24560

ath:AT5G65450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.576

Rank 1 · TkA07G256090 · TK1151

Cytoplasm0.395

Rank 2 · TkA07G256090 · TK1151

Mitochondrion0.067

Rank 3 · TkA07G256090 · TK1151

Cell membrane0.065

Rank 4 · TkA07G256090 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA07G256090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01753zf-MYND82-119 aa

PF24324MYND_ZMYND11_ZMYD882-119 aa

PF00443UCH175-479 aa

PF13423UCH_1176-461 aa

PF01753zf-MYND210-217 aa

PF24324MYND_ZMYND11_ZMYD8210-217 aa

PF01753zf-MYND308-316 aa

PF01753zf-MYND351-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G256090	`PF01753`	zf-MYND	82	119	2.7e-09	37.6
TkA07G256090	`PF24324`	MYND_ZMYND11_ZMYD8	82	119	0.0012	19.7
TkA07G256090	`PF00443`	UCH	175	479	7.1e-56	190.4
TkA07G256090	`PF13423`	UCH_1	176	461	1.8e-20	74.6
TkA07G256090	`PF01753`	zf-MYND	210	217	2.7e-09	37.6
TkA07G256090	`PF24324`	MYND_ZMYND11_ZMYD8	210	217	0.0012	19.7
TkA07G256090	`PF01753`	zf-MYND	308	316	2.7e-09	37.6
TkA07G256090	`PF01753`	zf-MYND	351	363	2.7e-09	37.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XW5`	Arabidopsis thaliana	sp\|Q67XW5\|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18	60.200%	Swiss-Prot	Medium
`Q9SJA1`	Arabidopsis thaliana	sp\|Q9SJA1\|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19	60.300%	Swiss-Prot	High
`Q9FPS9`	Arabidopsis thaliana	sp\|Q9FPS9\|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15	53.200%	Swiss-Prot	Low
`Q9FKP5`	Arabidopsis thaliana	sp\|Q9FKP5\|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17	49.600%	Swiss-Prot	Medium
`Q0E2F9`	Oryza sativa subsp. japonica	sp\|Q0E2F9\|UBP15_ORYSJ Ubiquitin C-terminal hydrolase 15	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card