TkA07G255520 | RubberDandelionOmics

Gene overview

TkA07G255520

Reference: TK1151 Chr: Chr07 Coordinates: 63884654-63889578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1903 bp · TkA07G255520|TK1151|cDNA

TTCAAATGCACACCAAACATCCCTATATTTATGGGTTAAATCCGGGAGGGCAGACCATTCTTACAGCGTTCATCACCTCAAAAGTAGACCGCAGAAATAGTGCGGTCTCTTTAGCTGTGGACTACTGTCTCTGCGTTCTCTCTAGGGTTTCCATCATTATTCAACTTAACTTGTATCTATCTCTGTAGAATCACATATCACATTCAAATGTATAGCGGTTCCAGTGATGGGGAAAGCCACGATACATCATCGGTGGCGTC...

CDS

Download CDS FASTA

1443 bp · TkA07G255520|TK1151|CDS

ATGTATAGCGGTTCCAGTGATGGGGAAAGCCACGATACATCATCGGTGGCGTCTAGGAAGCTTCCGCCGGCTTCTTCGATGCTGTGGGTCCGTAACCTCCGCCGTTACATCGGATCCGGTGCCGGTCTTGGCTCTGAAGCTTTAATGGAGCTTGAAACAAAAAGAATATTGCTTGATATCTTCAAGGAGAAGCAACAAAAGAGTGCTGAAGCTGGCACAATCCCAAGTTTCTATAAGAAGAAACCAGAGGATGGTTCCAT...

Protein

Download Protein FASTA

480 aa · TkA07G255520|TK1151|PROTEIN

MYSGSSDGESHDTSSVASRKLPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLDIFKEKQQKSAEAGTIPSFYKKKPEDGSISSRVQRLAKFRFLKKQSDQLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLLPHEMENYIRGLIPNLAQLRDMPGTFVQMYCRIAAPKFFFFCDPNRRGKACI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G255520`
TK1151 ID	TkA07G255520
OH-1004 ID	LXL04_028970
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G255520

Location Chr07:63884654-63889578 (-)

Description Similar to TON2: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18580`	Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton.	The Arabidopsis TONNEAU2 gene encodes a putative novel protein phosphatase 2A regulatory subunit essential for the control of the cortical cytoskeleton.2002 · DOI: 10.1105/tpc.010402 TONNEAU2/FASS regulates the geometry of microtubule nucleation and cortical array organization in interphase Arabidopsis cells.2012 · DOI: 10.1105/tpc.111.094367

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028970 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000913 preprophase band assembly Biological Process

GO:0002759 regulation of antimicrobial humoral response Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0032147 activation of protein kinase activity Biological Process

GO:0035303 regulation of dephosphorylation Biological Process

GO:0051900 regulation of mitochondrial depolarization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT5G18580

bta:533147

hsa:55012

mmu:59032

rno:362739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA07G255520 · TK1151

Nucleus0.253

Rank 2 · TkA07G255520 · TK1151

Cell membrane0.238

Rank 3 · TkA07G255520 · TK1151

Mitochondrion0.077

Rank 4 · TkA07G255520 · TK1151

Golgi apparatus0.075

Rank 5 · TkA07G255520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13202EF-hand_584-88 aa

PF10591SPARC_Ca_bdg87-125 aa

PF13405EF-hand_697-114 aa

PF17958EF-hand_1397-116 aa

PF13499EF-hand_798-144 aa

PF25578EF-hand_STIM1100-117 aa

PF13833EF-hand_8101-116 aa

PF00219IGFBP118-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G255520	`PF13202`	EF-hand_5	84	88	1.8e-05	24.7
TkA07G255520	`PF10591`	SPARC_Ca_bdg	87	125	0.036	15.1
TkA07G255520	`PF13405`	EF-hand_6	97	114	1.3e-09	37.6
TkA07G255520	`PF17958`	EF-hand_13	97	116	0.0094	16.4
TkA07G255520	`PF13499`	EF-hand_7	98	144	3.6e-09	37.5
TkA07G255520	`PF25578`	EF-hand_STIM1	100	117	1.3	9.8
TkA07G255520	`PF13833`	EF-hand_8	101	116	2e-05	24.9
TkA07G255520	`PF00219`	IGFBP	118	157	0.28	12.6
TkA07G255520	`PF00036`	EF-hand_1	134	143	2.3e-09	36.9
TkA07G255520	`PF13405`	EF-hand_6	164	175	1.3e-09	37.6
TkA07G255520	`PF00036`	EF-hand_1	164	175	2.3e-09	36.9
TkA07G255520	`PF13499`	EF-hand_7	166	175	3.6e-09	37.5
TkA07G255520	`PF13833`	EF-hand_8	194	206	2e-05	24.9
TkA07G255520	`PF00036`	EF-hand_1	197	218	2.3e-09	36.9
TkA07G255520	`PF10591`	SPARC_Ca_bdg	197	221	0.036	15.1
TkA07G255520	`PF13499`	EF-hand_7	198	225	3.6e-09	37.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FEE2`	Arabidopsis thaliana	sp\|Q9FEE2\|TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2	89.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card