TkA07G253910 | RubberDandelionOmics

Gene overview

TkA07G253910

Reference: TK1151 Chr: Chr07 Coordinates: 63337246-63340702 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1220 bp · TkA07G253910|TK1151|cDNA

GGTAAATGCTAAACAGGTAGTTGAATTTGATTCCAGAGTGTCGTCGGGTCGTTCTTTTGACTTCGCGAAGCACTTCTTCTATGGCAGATCTGCTGTGTTGTCTCTGAAGAGCAATATTGCAGAAATATACCTAACTCCGCCATCGTCAACCCATCTAAAGTGAAACAAATTTCATGGAAACCCAGGGCTTTCGTGTACGAGGGTTTTCTTACGGAAGAAGAATGCGATCACATGGTTTCTCTAGCCAAATCGGAGCTGAA...

CDS

Download CDS FASTA

531 bp · TkA07G253910|TK1151|CDS

ATGCAAGTATTGAGATATGGGCACGGCCAAAAGTATGACCCACACTTTGATTACTTCACGGACCCTGTAAATGTTGCACATGGCGGACACCGCATTGCAACTGTGCTCATGTATCTAAGTCATGTTGAAGAAGGTGGCGAGACGGTTTTCCCATCCGCACAGAAGGAGGCTTCACGTCATAAACCATCAAAACCAGACGAGAATTTATCCGAATGTGCAAAGAAAGGAATTGCAGTAAAACCGAAAAAAGGAGATGCACT...

Protein

Download Protein FASTA

176 aa · TkA07G253910|TK1151|PROTEIN

MQVLRYGHGQKYDPHFDYFTDPVNVAHGGHRIATVLMYLSHVEEGGETVFPSAQKEASRHKPSKPDENLSECAKKGIAVKPKKGDALLFFSLYPTAIPDTTSLHGGCPVVKGEKWSATKWIHVDSFDKIIESGGNCKDENENCERWAALGECTKNKEYMLGTPELPGYCRRSCKLC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G253910`
TK1151 ID	TkA07G253910
OH-1004 ID	LXL04_028949
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 62.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G253910

Location Chr07:63337246-63340702 (-)

Description Similar to P4H4: Probable prolyl 4-hydroxylase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18900`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g06300`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28480`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28490`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At1g20270`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0018401 peptidyl-proline hydroxylation to 4-hydroxy-L-proline Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20270

ath:AT3G06300

ath:AT3G28480

ath:AT3G28490

ath:AT5G18900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.372

Rank 1 · TkA07G253910 · TK1151

Cytoplasm0.231

Rank 2 · TkA07G253910 · TK1151

Lysosome / Vacuole0.155

Rank 3 · TkA07G253910 · TK1151

Extracellular0.150

Rank 4 · TkA07G253910 · TK1151

Cell membrane0.080

Rank 5 · TkA07G253910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF136402OG-FeII_Oxy_31-122 aa

PF031712OG-FeII_Oxy1-122 aa

PF137592OG-FeII_Oxy_535-92 aa

PF01549ShK135-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G253910	`PF13640`	2OG-FeII_Oxy_3	1	122	2e-21	77.5
TkA07G253910	`PF03171`	2OG-FeII_Oxy	1	122	2.7e-09	38.0
TkA07G253910	`PF13759`	2OG-FeII_Oxy_5	35	92	0.22	12.6
TkA07G253910	`PF01549`	ShK	135	176	2.1e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAN3`	Arabidopsis thaliana	sp\|Q8LAN3\|P4H4_ARATH Probable prolyl 4-hydroxylase 4	72.700%	Swiss-Prot	High
`F4JAU3`	Arabidopsis thaliana	sp\|F4JAU3\|P4H2_ARATH Prolyl 4-hydroxylase 2	73.900%	Swiss-Prot	High
`Q8L970`	Arabidopsis thaliana	sp\|Q8L970\|P4H7_ARATH Probable prolyl 4-hydroxylase 7	60.800%	Swiss-Prot	High
`F4J0A8`	Arabidopsis thaliana	sp\|F4J0A8\|P4H6_ARATH Probable prolyl 4-hydroxylase 6	55.600%	Swiss-Prot	High
`Q9LN20`	Arabidopsis thaliana	sp\|Q9LN20\|P4H3_ARATH Probable prolyl 4-hydroxylase 3	61.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card