TkA07G252660 | RubberDandelionOmics

Gene overview

TkA07G252660

Reference: TK1151 Chr: Chr07 Coordinates: 63046307-63049692 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA07G252660|TK1151|cDNA

ATCCGCCACTGTTCACAGTATCCCATGCCATACCCAATGCAGTCAAACTCTGGTGCAAACAGTGTAAACCCCTCAAATCCAGGTTCTCAGATCATGCGGCCAGTGAACAGCCAAGGGCAGCCTCATCCTAATCATCCTCACCCAACACAACAACCTTTGTCACAGGCCATGCACACTAACATCGGTTCAACTGGAAAGCAAGCAATTGGTGACTCATCTGCTGATTGGAGGTCTCAGCTGCATGCAGATTTCCGACAAAA...

CDS

Download CDS FASTA

510 bp · TkA07G252660|TK1151|CDS

ATGCCATACCCAATGCAGTCAAACTCTGGTGCAAACAGTGTAAACCCCTCAAATCCAGGTTCTCAGATCATGCGGCCAGTGAACAGCCAAGGGCAGCCTCATCCTAATCATCCTCACCCAACACAACAACCTTTGTCACAGGCCATGCACACTAACATCGGTTCAACTGGAAAGCAAGCAATTGGTGACTCATCTGCTGATTGGAGGTCTCAGCTGCATGCAGATTTCCGACAAAAGATCGTGAATAAACTAATGGATTC...

Protein

Download Protein FASTA

169 aa · TkA07G252660|TK1151|PROTEIN

MPYPMQSNSGANSVNPSNPGSQIMRPVNSQGQPHPNHPHPTQQPLSQAMHTNIGSTGKQAIGDSSADWRSQLHADFRQKIVNKLMDSLKMLIPFGGHERLHELEKIVVRFEERIYTAATSQSEYMRKISTKLMTMVPRSQNLMTYAIQSNSGASSVNPFDPEDLRSCKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G252660`
TK1151 ID	TkA07G252660
OH-1004 ID	LXL04_028943
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.266 / OH-1004 90.960 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G252660

Location Chr07:63046307-63049692 (+)

Description Similar to MED15A: Mediator of RNA polymerase II transcription subunit 15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15780`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028943 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0031490 chromatin DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA07G252660 · TK1151

Cytoplasm0.230

Rank 2 · TkA07G252660 · TK1151

Cell membrane0.018

Rank 3 · TkA07G252660 · TK1151

Mitochondrion0.017

Rank 4 · TkA07G252660 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA07G252660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09606Med15_N65-137 aa

PF02172KIX65-135 aa

PF16987KIX_266-141 aa

PF28865REX3_N77-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G252660	`PF09606`	Med15_N	65	137	5.7e-07	29.9
TkA07G252660	`PF02172`	KIX	65	135	0.00015	22.7
TkA07G252660	`PF16987`	KIX_2	66	141	1.6e-25	89.5
TkA07G252660	`PF28865`	REX3_N	77	143	0.019	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I171`	Arabidopsis thaliana	sp\|F4I171\|MD15A_ARATH Mediator of RNA polymerase II transcription subunit 15a	53.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card