Gene Card
Gene overview
cDNA / CDS / Protein Sequences
345 bp · TkA07G251060|TK1151|cDNA
CAAGAAGCAAGTCTGGAAAGGGAGAAAGTCATCACGTACATTTCTTACTTGGATCGACCGCCAACACCTTTCACCGGTGTCGCCATCGATCAACACCCAACCCTAGCTTTCTATCACCCATCTTCCATGTCCGATTTCGCATCCGGTTTAGGTGGGTTCTCCAGGTTTCGTATTCCAGCACAAATTCAACGTGAAGAGGAGAACACGACGACATCTCCGACAAACCGTCCTCTGCATCCTCCATTCGATTCTCGCCTGTT...
345 bp · TkA07G251060|TK1151|CDS
CAAGAAGCAAGTCTGGAAAGGGAGAAAGTCATCACGTACATTTCTTACTTGGATCGACCGCCAACACCTTTCACCGGTGTCGCCATCGATCAACACCCAACCCTAGCTTTCTATCACCCATCTTCCATGTCCGATTTCGCATCCGGTTTAGGTGGGTTCTCCAGGTTTCGTATTCCAGCACAAATTCAACGTGAAGAGGAGAACACGACGACATCTCCGACAAACCGTCCTCTGCATCCTCCATTCGATTCTCGCCTGTT...
Protein
Download Protein FASTA114 aa · TkA07G251060|TK1151|PROTEIN
QEASLEREKVITYISYLDRPPTPFTGVAIDQHPTLAFYHPSSMSDFASGLGGFSRFRIPAQIQREEENTTTSPTNRPLHPPFDSRLFLRSVKFHKTFSIFINFSTNTMRDFCFP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G251060 |
|---|---|
| TK1151 ID | TkA07G251060 |
| OH-1004 ID | LXL04_019598 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 66.700 |
| Protein coverage (%) | TK1151 71.053 / OH-1004 44.186Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G251060 |
|---|---|
| Location | Chr07:62615023-62615367 (+) |
| Description | Similar to TCP3: Transcription factor TCP3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009733 response to auxin Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010150 leaf senescence Biological Process GO:0048366 leaf development Biological Process GO:0048825 cotyledon development Biological Process GO:0048826 cotyledon morphogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0001216 DNA-binding transcription activator activity Molecular Function GO:0003677 DNA binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G53230 ath:AT3G15030 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.