TkA07G245660 | RubberDandelionOmics

Gene overview

TkA07G245660

Reference: TK1151 Chr: Chr07 Coordinates: 61288173-61295130 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · TkA07G245660|TK1151|cDNA

ATGTTTCTCTCTTCATCCGCCACCAAGTCCCAGATGGGTTTCCTTCAAACAAGATACCCTAATCTTCATATTAAGGTTACTGCTCGATCTCTGTCTCATTCTCAGCCTGCTGCCTCCACCGAGCCTTCGTATGAGAACACGATTTCCAGTCCCAAAGATGGAGTGAAGTTATACGTTGGATTGCCGATGAATTCAGTGTCTGATTTCCATTCCATAAACCATTCACGAGCAATTTCAGCAGGACTTAGGGTTTTAAAGTT...

CDS

Download CDS FASTA

1527 bp · TkA07G245660|TK1151|CDS

ATGTTTCTCTCTTCATCCGCCACCAAGTCCCAGATGGGTTTCCTTCAAACAAGATACCCTAATCTTCATATTAAGGTTACTGCTCGATCTCTGTCTCATTCTCAGCCTGCTGCCTCCACCGAGCCTTCGTATGAGAACACGATTTCCAGTCCCAAAGATGGAGTGAAGTTATACGTTGGATTGCCGATGAATTCAGTGTCTGATTTCCATTCCATAAACCATTCACGAGCAATTTCAGCAGGACTTAGGGTTTTAAAGTT...

Protein

Download Protein FASTA

508 aa · TkA07G245660|TK1151|PROTEIN

MFLSSSATKSQMGFLQTRYPNLHIKVTARSLSHSQPAASTEPSYENTISSPKDGVKLYVGLPMNSVSDFHSINHSRAISAGLRVLKLLGVEGVELPIWWGVAEKEAMGKYEWSGYLTLVEMIQKAGLKLHVSLCFHGCKQENIPLPRWVSELGKSEPDIFFADRSGKRYKDCLSFGIDNLPVFDGKTAMNVYQGFAESFKTSFSSFMDSTITGITIGMGADGELRYPSHQDQNENKLGLGAGEFQCYDRNMMTVLKNHAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G245660`
TK1151 ID	TkA07G245660
OH-1004 ID	LXL04_028894
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.700
Protein coverage (%)	TK1151 100.000 / OH-1004 94.249 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G245660

Location Chr07:61288173-61295130 (+)

Description Similar to BAM9: Inactive beta-amylase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18670`	Inactive beta-amylase 9.	No verified direct reference in this release
`At4g17090`	Beta-amylase activity.	RNA interference of Arabidopsis beta-amylase8 prevents maltose accumulation upon cold shock and increases sensitivity of PSII photochemical efficiency to freezing stress.2005 · DOI: 10.1111/j.1365-313x.2005.02565.x Glucan, water dikinase activity stimulates breakdown of starch granules by plastidial beta-amylases.2007 · DOI: 10.1104/pp.107.104224

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0141200`	Possesses beta-amylase activity in vitro.	No verified direct reference in this release
`Os10g0465700`	Possesses beta-amylase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000024 maltose biosynthetic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0016161 beta-amylase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23920

ath:AT4G17090

ath:AT5G18670

ath:AT5G55700

dosa:Os03g0141200

osa:4331577

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.921

Rank 1 · TkA07G245660 · TK1151

Mitochondrion0.067

Rank 2 · TkA07G245660 · TK1151

Cytoplasm0.057

Rank 3 · TkA07G245660 · TK1151

Nucleus0.054

Rank 4 · TkA07G245660 · TK1151

Peroxisome0.030

Rank 5 · TkA07G245660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01373Glyco_hydro_1459-471 aa

PF01301Glyco_hydro_3582-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G245660	`PF01373`	Glyco_hydro_14	59	471	2.4e-95	320.7
TkA07G245660	`PF01301`	Glyco_hydro_35	82	130	0.13	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYW2`	Arabidopsis thaliana	sp\|Q8VYW2\|BAM9_ARATH Inactive beta-amylase 9	56.900%	Swiss-Prot	High
`O23553`	Arabidopsis thaliana	sp\|O23553\|BAM3_ARATH Beta-amylase 3, chloroplastic	38.900%	Swiss-Prot	Medium
`Q10RZ1`	Oryza sativa subsp. japonica	sp\|Q10RZ1\|BAMY2_ORYSJ Beta-amylase 2, chloroplastic	38.500%	Swiss-Prot	Medium
`Q9AV88`	Oryza sativa subsp. japonica	sp\|Q9AV88\|BAMY1_ORYSJ Beta-amylase 1, chloroplastic	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card