TkA07G230470 | RubberDandelionOmics

Gene overview

TkA07G230470

Reference: TK1151 Chr: Chr07 Coordinates: 57690554-57691574 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA07G230470|TK1151|cDNA

ATGGAAGTTGGCAATGTGAACAGCAAGCATTTTGTATTATCTCTCAAGGTCAAAAGTGTTCTTGACCCTTGTGAGGATGAAAACATGAGTGTGGGAGGTGATTCGATGGATAGTGAGGCCAGCCTTTCTGATGATGAATACATAATGGCACCAGTAGATAAACAAGCAGAGCAACCAGATGATACCATGGCTGATGAAGATGATACTCAAGATCCAGATGAAGATGAACAACAACTGAACCATGTAAAGGAGTGGATTAG...

CDS

Download CDS FASTA

510 bp · TkA07G230470|TK1151|CDS

ATGGAAGTTGGCAATGTGAACAGCAAGCATTTTGTATTATCTCTCAAGGTCAAAAGTGTTCTTGACCCTTGTGAGGATGAAAACATGAGTGTGGGAGGTGATTCGATGGATAGTGAGGCCAGCCTTTCTGATGATGAATACATAATGGCACCAGTAGATAAACAAGCAGAGCAACCAGATGATACCATGGCTGATGAAGATGATACTCAAGATCCAGATGAAGATGAACAACAACTGAACCATGTAAAGGAGTGGATTAG...

Protein

Download Protein FASTA

169 aa · TkA07G230470|TK1151|PROTEIN

MEVGNVNSKHFVLSLKVKSVLDPCEDENMSVGGDSMDSEASLSDDEYIMAPVDKQAEQPDDTMADEDDTQDPDEDEQQLNHVKEWISSYHLDNLDVPDVLSNFPDISLVMNKLVNEGILSKSGTDSFNIKRPRKTEFEFDAVKEEGEKKSPSTMLDGDMYMKALFHYYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G230470`
TK1151 ID	TkA07G230470
OH-1004 ID	LXL04_032988
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.400
Protein coverage (%)	TK1151 98.225 / OH-1004 29.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G230470

Location Chr07:57690554-57691574 (-)

Description Similar to ASY1: Meiosis-specific protein ASY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: F4HRV8`	Required for normal meiosis in male and female gametophytes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0506800`	Essential factor for meiotic homologous chromosome pairing (synapsis).	An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis.2004 · DOI: 10.1007/s00438-003-0934-z PAIR2 is essential for homologous chromosome synapsis in rice meiosis I.2006 · DOI: 10.1242/jcs.02736

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032988 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007130 synaptonemal complex assembly Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0042138 meiotic DNA double-strand break formation Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0051177 meiotic sister chromatid cohesion Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0051598 meiotic recombination checkpoint signaling Biological Process

GO:0060629 regulation of homologous chromosome segregation Biological Process

GO:0000228 nuclear chromosome Cellular Component

KEGG gene cross-reference

ath:AT1G67370

ath:AT4G32200

dosa:Os09g0506800

rno:365868

xla:496240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.879

Rank 1 · TkA07G230470 · TK1151

Cytoplasm0.270

Rank 2 · TkA07G230470 · TK1151

Mitochondrion0.035

Rank 3 · TkA07G230470 · TK1151

Cell membrane0.024

Rank 4 · TkA07G230470 · TK1151

Golgi apparatus0.014

Rank 5 · TkA07G230470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HRV8`	Arabidopsis thaliana	sp\|F4HRV8\|ASY1_ARATH Meiosis-specific protein ASY1	46.800%	Swiss-Prot	Medium
`Q76CY8`	Oryza sativa subsp. japonica	sp\|Q76CY8\|PAIR2_ORYSJ Meiosis-specific protein PAIR2	37.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card