Gene Card
Gene overview
cDNA / CDS / Protein Sequences
408 bp · TkA07G221970|TK1151|cDNA
ATGGTCTTAAAAAGGAGGGTTGTTGATCCTAATGAGTTGCTTAAGACAGCAATTGCTAAAGCTGGATACTCCGAAAAGATTGTCATTGGAATGGATGTTGCTGCATCTGAGTTTTATGCCGAGAAGGGAAAGACCTACGATCTGAACTTCAAGGAAGTATTGATTCGTTATGTTGGTCTACTGATTCAGTTCTTAATTAGACCAGTTATTCATACACGCACGTCAGGTATGACATCTCGTAAACGCTCAAACGATGATGA...
408 bp · TkA07G221970|TK1151|CDS
ATGGTCTTAAAAAGGAGGGTTGTTGATCCTAATGAGTTGCTTAAGACAGCAATTGCTAAAGCTGGATACTCCGAAAAGATTGTCATTGGAATGGATGTTGCTGCATCTGAGTTTTATGCCGAGAAGGGAAAGACCTACGATCTGAACTTCAAGGAAGTATTGATTCGTTATGTTGGTCTACTGATTCAGTTCTTAATTAGACCAGTTATTCATACACGCACGTCAGGTATGACATCTCGTAAACGCTCAAACGATGATGA...
Protein
Download Protein FASTA135 aa · TkA07G221970|TK1151|PROTEIN
MVLKRRVVDPNELLKTAIAKAGYSEKIVIGMDVAASEFYAEKGKTYDLNFKEVLIRYVGLLIQFLIRPVIHTRTSGMTSRKRSNDDDDDFVYGDKGFCAIFESMILGSKLHISVIDLWETLLNHEEQRRNKNSTS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G221970 |
|---|---|
| TK1151 ID | TkA07G221970 |
| OH-1004 ID | LXL04_013674 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.000 |
| Protein coverage (%) | TK1151 99.259 / OH-1004 24.453Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G221970 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:55642901-55644072 (+) | ||||||||||||
| Description | Similar to CAR5: Protein C2-DOMAIN ABA-RELATED 5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0043547 positive regulation of GTPase activity Biological Process GO:1900426 positive regulation of defense response to bacterium Biological Process GO:1901002 positive regulation of response to salt stress Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT1G48590 ath:AT3G17980 ath:AT5G37740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00113Enolase_C12-52 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G221970 | PF00113 | Enolase_C | 12 | 52 | 5.5e-12 | 46.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.