TkA07G201970 | RubberDandelionOmics

Gene overview

TkA07G201970

Reference: TK1151 Chr: Chr07 Coordinates: 50993857-50994394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA07G201970|TK1151|cDNA

ATGGTTCGTGTTGCAGCTCCGGGCCGTGGAACGGTGGAAGATTGTATTCTTGGTGAAATCCCAAAAACTTCTGGTGAAGTTAGGATATGTGGATCTGCAGCTTATGTATCTCAGTCAGCATGGATACAATCGGGGAATATAGAAGAAAATGTGTTATTTGGTAATCCAATGGATAAGGCCAAGTACAAGAGAATACTTCATGCGTGTTCTTTAAAGAAAGATTTGGAGCTTTTCTCACGTGGAGATCAAACCATCATTGG...

CDS

Download CDS FASTA

426 bp · TkA07G201970|TK1151|CDS

ATGGTTCGTGTTGCAGCTCCGGGCCGTGGAACGGTGGAAGATTGTATTCTTGGTGAAATCCCAAAAACTTCTGGTGAAGTTAGGATATGTGGATCTGCAGCTTATGTATCTCAGTCAGCATGGATACAATCGGGGAATATAGAAGAAAATGTGTTATTTGGTAATCCAATGGATAAGGCCAAGTACAAGAGAATACTTCATGCGTGTTCTTTAAAGAAAGATTTGGAGCTTTTCTCACGTGGAGATCAAACCATCATTGG...

Protein

Download Protein FASTA

141 aa · TkA07G201970|TK1151|PROTEIN

MVRVAAPGRGTVEDCILGEIPKTSGEVRICGSAAYVSQSAWIQSGNIEENVLFGNPMDKAKYKRILHACSLKKDLELFSRGDQTIIGDRGINWSGGQKQRVQLARALYQDADIYLLDDPFNAVDAHTGSELFKLEFNCTSW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G201970`
TK1151 ID	TkA07G201970
OH-1004 ID	LXL04_020251
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 94.326 / OH-1004 64.251 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G201970

Location Chr07:50993857-50994394 (+)

Description Similar to ABCC5: ABC transporter C family member 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04120`	Pump for glutathione S-conjugates.	The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875 The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045 The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247
`At3g13080`	Pump for glutathione S-conjugates.	An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XCD4`	ABC transporter that may affect phytic acid transport and compartmentalization.	No verified direct reference in this release
`Os03g0142800`	ABC transporter that may affect phytic acid transport and compartmentalization.	Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020251 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008281 sulfonylurea receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G04120

ath:AT3G13080

dosa:Os03g0142800

zma:100125659

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.548

Rank 1 · TkA07G201970 · TK1151

Nucleus0.193

Rank 2 · TkA07G201970 · TK1151

Peroxisome0.179

Rank 3 · TkA07G201970 · TK1151

Mitochondrion0.105

Rank 4 · TkA07G201970 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkA07G201970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005ABC_tran10-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G201970	`PF00005`	ABC_tran	10	121	3.4e-11	44.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7GB25`	Arabidopsis thaliana	sp\|Q7GB25\|AB5C_ARATH ABC transporter C family member 5	79.400%	Swiss-Prot	High
`Q9LK64`	Arabidopsis thaliana	sp\|Q9LK64\|AB3C_ARATH ABC transporter C family member 3	66.700%	Swiss-Prot	High
`A2XCD4`	Oryza sativa subsp. indica	sp\|A2XCD4\|AB13C_ORYSI ABC transporter C family member 13	76.900%	Swiss-Prot	High
`Q10RX7`	Oryza sativa subsp. japonica	sp\|Q10RX7\|AB13C_ORYSJ ABC transporter C family member 13	76.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card