Gene Card
Gene overview
cDNA / CDS / Protein Sequences
435 bp · TkA07G198440|TK1151|cDNA
CTGCTCCACGAGGAGTTCAAAAACTTCCATCGCGAGACAGAGAGAAAGATACAAGGGAGATCGGAGAGCTCCTGGACGGAGCCGACGAACCACGCGGGAGAGAGAGCGGCAGGAAGCAGGAAGCAATCGCCGGTTCCCAAGACCGCTGACCACGCCGATCTCCGACAGCAGCCCCAGCGGCGTCCAGCGATTTCTCGGTCTCAACAGATGAATTTCCGGGTCGATTTCCGGTGTCGATTTCAACCGTCTCGTCTCTCAGG...
435 bp · TkA07G198440|TK1151|CDS
CTGCTCCACGAGGAGTTCAAAAACTTCCATCGCGAGACAGAGAGAAAGATACAAGGGAGATCGGAGAGCTCCTGGACGGAGCCGACGAACCACGCGGGAGAGAGAGCGGCAGGAAGCAGGAAGCAATCGCCGGTTCCCAAGACCGCTGACCACGCCGATCTCCGACAGCAGCCCCAGCGGCGTCCAGCGATTTCTCGGTCTCAACAGATGAATTTCCGGGTCGATTTCCGGTGTCGATTTCAACCGTCTCGTCTCTCAGG...
Protein
Download Protein FASTA144 aa · TkA07G198440|TK1151|PROTEIN
LLHEEFKNFHRETERKIQGRSESSWTEPTNHAGERAAGSRKQSPVPKTADHADLRQQPQRRPAISRSQQMNFRVDFRCRFQPSRLSGTYLNPYYLSPLSICHLKSRRRNQPRSKDFTASSDFVYFVFGFHTTDFDSSYNELIQL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G198440 |
|---|---|
| TK1151 ID | TkA07G198440 |
| OH-1004 ID | LXL04_000057 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 32.787Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G198440 |
|---|---|
| Location | Chr07:50127584-50128018 (+) |
| Description | Similar to PLC2: Phosphoinositide phospholipase C 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006950 response to stress Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009553 embryo sac development Biological Process GO:0009556 microsporogenesis Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0010601 positive regulation of auxin biosynthetic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0042742 defense response to bacterium Biological Process GO:0048015 phosphatidylinositol-mediated signaling Biological Process |
| KEGG gene cross-reference | ath:AT2G40116 ath:AT3G08510 ath:AT3G55940 ath:AT4G38530 ath:AT5G58670 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.