TkA07G189630 | RubberDandelionOmics

Gene overview

TkA07G189630

Reference: TK1151 Chr: Chr07 Coordinates: 48227013-48231588 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2439 bp · TkA07G189630|TK1151|cDNA

GTACAATCTGCAAAACCTTGAGGCAGATGAGAAACTATGTCGTCTTAGGTATTTTTATCAAAATTGAGACCCTTGAGGCATCACCTTCTATCTTCTCCCCGGGTCGTTGCGCACCGTCTGCGTACACAATTTCTGGCGATCTTTCAAGTCCGTTTTCCTAAACCGGCGACGAAACCCTACCAGTCGCTTATGAATCATCATTGACTCATCTCTCTCGAAAATCATTTTAAACCTCAACCTTCGAAATTCCTCGAAATTAC...

CDS

Download CDS FASTA

1842 bp · TkA07G189630|TK1151|CDS

ATGGAATTTTATGCAACCAATCCGGGACCTATTGACGATTCTGTATTGTATGATCAAGAAAAGCATGTTTCATCAGCTGTTTGGGAGGGCCAGGAGCGTGGTGCACTTAGATGCCATGAACACACATCAAAGCTAGATCAATGGACACTGACACCAAACCAAATCGAATTAGTAAAAAAATCCGGATTCGGTTACTTAAGACTAATCCCAGCCATCAGTCTAGACAACCCCTTAATCTCCGCCCTAGTTGAAAGATGGAG...

Protein

Download Protein FASTA

613 aa · TkA07G189630|TK1151|PROTEIN

MEFYATNPGPIDDSVLYDQEKHVSSAVWEGQERGALRCHEHTSKLDQWTLTPNQIELVKKSGFGYLRLIPAISLDNPLISALVERWRRETNTFHFTVGEMSVTLEDVGYLLGLPIDGDPVIGVTYTTCEAACIKYLGRAPDSGSTSGGMVKLSWLKETFARCPEGAPLDVIERHTRAYLLYLVGSTVFSTTTGNKVPVMYLPLFENFDQAGRYAWGAAALSFLYRALGNASLKSQSTISGCLTLLQCWSYFRLNIGRPRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G189630`
TK1151 ID	TkA07G189630
OH-1004 ID	LXL04_028697
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 92.598 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G189630

Location Chr07:48227013-48231588 (-)

Description Similar to At2g04865: Protein MAIN-LIKE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04865`	Maybe required to maintain cell division activity in meristematic cells.	No verified direct reference in this release
`At2g25010`	Acts as an important factor for cell fate determination and maintenance throughout plant development.	MAIN-LIKE1 is a crucial factor for correct cell division and differentiation in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12455
`At1g17930`	Required for the organization of the root apical meristem (RAM) and the shoot apical meristem (SAM).	Identification of MAIN, a factor involved in genome stability in the meristems of Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12215
`At1g48120`	Maybe required to maintain cell division activity in meristematic cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028697 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010073 meristem maintenance Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0048507 meristem development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0008483 transaminase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G17930

ath:AT1G48120

ath:AT2G04865

ath:AT2G25010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA07G189630 · TK1151

Cytoplasm0.113

Rank 2 · TkA07G189630 · TK1151

Cell membrane0.028

Rank 3 · TkA07G189630 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA07G189630 · TK1151

Mitochondrion0.011

Rank 5 · TkA07G189630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29561DUF856649-246 aa

PF10536PMD62-411 aa

PF09331DUF1985169-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G189630	`PF29561`	DUF8566	49	246	1.3e-20	74.8
TkA07G189630	`PF10536`	PMD	62	411	6.6e-110	368.3
TkA07G189630	`PF09331`	DUF1985	169	223	0.085	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IFD0`	Arabidopsis thaliana	sp\|F4IFD0\|MAIL2_ARATH Protein MAIN-LIKE 2	61.000%	Swiss-Prot	High
`Q9SK32`	Arabidopsis thaliana	sp\|Q9SK32\|MAIL1_ARATH Protein MAIN-LIKE 1	52.800%	Swiss-Prot	High
`Q9LMT7`	Arabidopsis thaliana	sp\|Q9LMT7\|MAIN_ARATH Protein MAINTENANCE OF MERISTEMS	48.900%	Swiss-Prot	Medium
`Q9LNG5`	Arabidopsis thaliana	sp\|Q9LNG5\|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog	34.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card