RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G185410
Reference: TK1151 Chr: Chr07 Coordinates: 47229245-47234717 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3580 bp · TkA07G185410|TK1151|cDNA

GGTAGATATACAACCAAAGGTGCATCGGGGCAGCGAGGGTTACTTGGGCAGGCAAAGGGAAAGAGTTTTTATGCGTTCAACGCTGAACCAATAATTCTTTGAAGCATAATTCCGCATACTAACAACAACAACCTCCTTGCCTCCAATTTTTGGTAAATTTTTGAAAAGACCCAACAATTTTGAAAACAAAGGAAGCAAACGGGGTTGTGAGTGCCTCCCGCCATGAGTACTCAAGTCTTGGAGAGGCAACAGAGCTCTTC...

CDS

Download CDS FASTA

3180 bp · TkA07G185410|TK1151|CDS

ATGAGTACTCAAGTCTTGGAGAGGCAACAGAGCTCTTCATCGTTGCCAGAAGACCATATCGATAACACCAAGACTCTGATTTGTGCTCTTAGTTTCCTCTCTCGCAATCTCCCTCTCCCTCCTGACGTTTTCGATGCTGTCTCTTCCATCTACACCGCCGCCTCCGAAGATGTTGACGCCAACGTCCCCGAAGATGCCCACGCTGGTGTTGACGCTACCGCCCCCGGTGGATCTGACTGCGACAAACAAGTCGATGATGT...

Protein

Download Protein FASTA

1059 aa · TkA07G185410|TK1151|PROTEIN

MSTQVLERQQSSSSLPEDHIDNTKTLICALSFLSRNLPLPPDVFDAVSSIYTAASEDVDANVPEDAHAGVDATAPGGSDCDKQVDDVSSPKNFQLQNGGDLMADLEEALLTHRSNHITGTEIAETRKKRIESHIQNRLTQLEELPTSRGEDLQSKCLLELYGLKLAELQRKVRSNVSSEYTLCLNCVYPEKQLFDWGMMRLSRPSYGVGDAFAVDSDNHLKKKRDAERLTKLEEEEKNRVETRKRKFFAEILNSIRELQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G185410
TK1151 IDTkA07G185410
OH-1004 IDLXL04_028648
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 99.717 / OH-1004 90.102
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G185410
LocationChr07:47229245-47234717 (+)
DescriptionSimilar to CHR12: Probable ATP-dependent DNA helicase CHR12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g06010 Probable chromatin-remodeling factor that is functionally redundant with CHR23 in root and shoot stem cell initiation, and root apical meristem (RAM) and shoot apical meristem (SAM) maintenance.
The SWI/SNF chromatin-remodeling gene AtCHR12 mediates temporary growth arrest in Arabidopsis thaliana upon perceiving environmental stress.2007 · DOI: 10.1111/j.1365-313x.2007.03185.x
Mutations in two non-canonical Arabidopsis SWI2/SNF2 chromatin remodeling ATPases cause embryogenesis and stem cell maintenance defects.2012 · DOI: 10.1111/tpj.12009
Reduced seed germination in Arabidopsis over-expressing SWI/SNF2 ATPase genes.2015 · DOI: 10.1111/ppl.12231
At5g19310 Probable chromatin-remodeling factor that is functionally redundant with CHR12 in root and shoot stem cell initiation and root apical meristem (RAM) and shoot apical meristem (SAM) maintenance.
Mutations in two non-canonical Arabidopsis SWI2/SNF2 chromatin remodeling ATPases cause embryogenesis and stem cell maintenance defects.2012 · DOI: 10.1111/tpj.12009
Over-expression of Arabidopsis AtCHR23 chromatin remodeling ATPase results in increased variability of growth and gene expression.2014 · DOI: 10.1186/1471-2229-14-76
Reduced seed germination in Arabidopsis over-expressing SWI/SNF2 ATPase genes.2015 · DOI: 10.1111/ppl.12231

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0144300 Probable chromatin-remodeling factor involved in root and shoot stem cell initiation, and root apical meristem (RAM) and shoot apical meristem (SAM) maintenance. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028648 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006261 DNA-templated DNA replication Biological Process
GO:0006302 double-strand break repair Biological Process
GO:0006338 chromatin remodeling Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0007064 mitotic sister chromatid cohesion Biological Process
GO:0009408 response to heat Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0010078 maintenance of root meristem identity Biological Process
GO:0010231 maintenance of seed dormancy Biological Process
GO:0010492 maintenance of shoot apical meristem identity Biological Process
KEGG gene cross-reference
ath:AT3G06010
ath:AT5G19310
dosa:Os05g0144300
osa:4337784
sce:YOR290C
spo:2542638
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.887
Rank 1 · TkA07G185410 · TK1151
Cytoplasm0.164
Rank 2 · TkA07G185410 · TK1151
Mitochondrion0.031
Rank 3 · TkA07G185410 · TK1151
Cell membrane0.024
Rank 4 · TkA07G185410 · TK1151
Endoplasmic reticulum0.014
Rank 5 · TkA07G185410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14619SnAC127-147 aa
PF14619SnAC226-246 aa
PF00271Helicase_C257-276 aa
PF14619SnAC271-273 aa
PF14619SnAC337-365 aa
PF04851ResIII409-570 aa
PF00176SNF2-rel_dom413-700 aa
PF28555Helicase_dom426-530 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G185410PF14619SnAC1271474.9e-1040.5
TkA07G185410PF14619SnAC2262464.9e-1040.5
TkA07G185410PF00271Helicase_C2572763e-2692.6
TkA07G185410PF14619SnAC2712734.9e-1040.5
TkA07G185410PF14619SnAC3373654.9e-1040.5
TkA07G185410PF04851ResIII4095702.2e-1144.7
TkA07G185410PF00176SNF2-rel_dom4137001.6e-95320.3
TkA07G185410PF28555Helicase_dom4265300.0001222.1
TkA07G185410PF00270DEAD4305752e-0525.1
TkA07G185410PF00271Helicase_C4905143e-2692.6
TkA07G185410PF28555Helicase_dom5646040.0001222.1
TkA07G185410PF04851ResIII6696942.2e-1144.7
TkA07G185410PF00270DEAD6726832e-0525.1
TkA07G185410PF11496HDA2-36818582.5e-1040.7
TkA07G185410PF00271Helicase_C7198323e-2692.6
TkA07G185410PF14619SnAC9259894.9e-1040.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4J9M5Arabidopsis thalianasp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR1268.200%Swiss-ProtHigh
F4K128Arabidopsis thalianasp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR2367.600%Swiss-ProtHigh
Q60EX7Oryza sativa subsp. japonicasp|Q60EX7|CHR19_ORYSJ Probable ATP-dependent DNA helicase CHR71963.100%Swiss-ProtHigh

JBrowse

View in Genome Browser