TkA07G178680 | RubberDandelionOmics

Gene overview

TkA07G178680

Reference: TK1151 Chr: Chr07 Coordinates: 45678331-45680659 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · TkA07G178680|TK1151|cDNA

CGAAAAACGAGTGTGCCCGAATTTCATCACAAACCTTCTCTTTATAGCGAGGGAGGCGTTAAAAATCGGGCGTAATAGCTGAGGGTTTAAGCTGCTGATTAAGTTGATTTATCGGTGAACTTTATCCGTTCTCATGGATCTGAATCCGCCTCCAGGAGAAAACTATGCGAACCCAAGGATATGCTTTTTCCATGTCCTCTTCAAGGCTGGAGCTTTGGCATTTTACATACTGTCGGCCCTGTTTTTTGATAGCTTTGTGA...

CDS

Download CDS FASTA

552 bp · TkA07G178680|TK1151|CDS

ATGGATCTGAATCCGCCTCCAGGAGAAAACTATGCGAACCCAAGGATATGCTTTTTCCATGTCCTCTTCAAGGCTGGAGCTTTGGCATTTTACATACTGTCGGCCCTGTTTTTTGATAGCTTTGTGATAATATTTGTGGTGACTGTTCTTCTATCTGCTCTTGATTTTTGGGTGGTGAAAAATGTGAGTGGTAGAATCTTAGTCGGTTTGAGGTGGTGGAATGAAATTGATGACAATGGTGAAAGTGTGTGGAAATTTGA...

Protein

Download Protein FASTA

183 aa · TkA07G178680|TK1151|PROTEIN

MDLNPPPGENYANPRICFFHVLFKAGALAFYILSALFFDSFVIIFVVTVLLSALDFWVVKNVSGRILVGLRWWNEIDDNGESVWKFECLDQESLARMNKKDSWLFWWTLYLTAVVWIFFGIFSLIRFQADYLLVVGVCLTLSVANIVGFTKCRKDAKKQIQAFASQTIANRFQSTLQSAFSVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G178680`
TK1151 ID	TkA07G178680
OH-1004 ID	LXL04_028641
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.268 / OH-1004 90.355 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G178680

Location Chr07:45678331-45680659 (-)

Description Similar to ECH: Golgi apparatus membrane protein-like protein ECHIDNA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09330`	Mediates trans-Golgi-network trafficking and cell elongation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028641 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007030 Golgi organization Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0009306 protein secretion Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0099402 plant organ development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G09330

ddi:DDB_G0276319

dme:Dmel_CG5021

hsa:51030

spo:2540332

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.443

Rank 1 · TkA07G178680 · TK1151

Endoplasmic reticulum0.337

Rank 2 · TkA07G178680 · TK1151

Cytoplasm0.300

Rank 3 · TkA07G178680 · TK1151

Cell membrane0.194

Rank 4 · TkA07G178680 · TK1151

Lysosome / Vacuole0.123

Rank 5 · TkA07G178680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05832DUF84613-152 aa

PF13829DUF419126-54 aa

PF20563DUF677335-60 aa

PF30251YmfE37-60 aa

PF13829DUF419198-159 aa

PF30251YmfE101-173 aa

PF20563DUF6773104-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G178680	`PF05832`	DUF846	13	152	2e-49	167.9
TkA07G178680	`PF13829`	DUF4191	26	54	0.57	10.2
TkA07G178680	`PF20563`	DUF6773	35	60	3.5	8.2
TkA07G178680	`PF30251`	YmfE	37	60	4.8	7.5
TkA07G178680	`PF13829`	DUF4191	98	159	0.57	10.2
TkA07G178680	`PF30251`	YmfE	101	173	4.8	7.5
TkA07G178680	`PF20563`	DUF6773	104	161	3.5	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEK2`	Arabidopsis thaliana	sp\|Q8LEK2\|TVP23_ARATH Golgi apparatus membrane protein-like protein ECHIDNA	84.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card