TkA07G171050 | RubberDandelionOmics

Gene overview

TkA07G171050

Reference: TK1151 Chr: Chr07 Coordinates: 43910220-43910582 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA07G171050|TK1151|cDNA

ATGGTTTCACACAACGAACTTGAATTATCTGATTCAGGCTACGCAATCCGCATCGACTTAATGACCAAAGTTTTTGGCATCGATGCAGCTGAACGTTACTTCCAAGGTTTACCCCCAAACGCCAAAGCAACCGAATCCTACACTTCTCTTCTCCACTCATACGCTGCATCAAAACTAACCACAAAAGTAGAAGATCTCTACCAAAAAATCAAACAATCAGGCCTAAAGTTAACCGCCATAACATACAACGAGCTCATGAC...

CDS

Download CDS FASTA

363 bp · TkA07G171050|TK1151|CDS

ATGGTTTCACACAACGAACTTGAATTATCTGATTCAGGCTACGCAATCCGCATCGACTTAATGACCAAAGTTTTTGGCATCGATGCAGCTGAACGTTACTTCCAAGGTTTACCCCCAAACGCCAAAGCAACCGAATCCTACACTTCTCTTCTCCACTCATACGCTGCATCAAAACTAACCACAAAAGTAGAAGATCTCTACCAAAAAATCAAACAATCAGGCCTAAAGTTAACCGCCATAACATACAACGAGCTCATGAC...

Protein

Download Protein FASTA

120 aa · TkA07G171050|TK1151|PROTEIN

MVSHNELELSDSGYAIRIDLMTKVFGIDAAERYFQGLPPNAKATESYTSLLHSYAASKLTTKVEDLYQKIKQSGLKLTAITYNELMTLYMSVGEVEKVFSIIQELKHQNVLNIITDNYGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G171050`
TK1151 ID	TkA07G171050
OH-1004 ID	LXL04_017157
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 91.667 / OH-1004 26.829 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G171050

Location Chr07:43910220-43910582 (-)

Description Similar to At5g09450: Pentatricopeptide repeat-containing protein At5g09450, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09450`	Pentatricopeptide repeat-containing protein At5g09450, mitochondrial.	No verified direct reference in this release
`At4g02820`	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial.	No verified direct reference in this release
`At4g01990`	Pentatricopeptide repeat-containing protein At4g01990, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000963 mitochondrial RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G02150

ath:AT2G20710

ath:AT4G02820

ath:AT5G09450

ath:AT5G27460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.508

Rank 1 · TkA07G171050 · TK1151

Cytoplasm0.145

Rank 2 · TkA07G171050 · TK1151

Plastid0.122

Rank 3 · TkA07G171050 · TK1151

Nucleus0.088

Rank 4 · TkA07G171050 · TK1151

Peroxisome0.034

Rank 5 · TkA07G171050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_245-86 aa

PF29070MSC6_N45-108 aa

PF01535PPR46-75 aa

PF13812PPR_346-89 aa

PF17177PPR_long46-107 aa

PF29834SOV1_C57-105 aa

PF23276TPR_2463-110 aa

PF13812PPR_366-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G171050	`PF13041`	PPR_2	45	86	1.7e-10	41.6
TkA07G171050	`PF29070`	MSC6_N	45	108	9.2e-06	25.7
TkA07G171050	`PF01535`	PPR	46	75	3e-09	37.2
TkA07G171050	`PF13812`	PPR_3	46	89	3.9e-09	37.2
TkA07G171050	`PF17177`	PPR_long	46	107	0.012	15.7
TkA07G171050	`PF29834`	SOV1_C	57	105	0.0073	16.1
TkA07G171050	`PF23276`	TPR_24	63	110	0.066	13.8
TkA07G171050	`PF13812`	PPR_3	66	110	3.9e-09	37.2
TkA07G171050	`PF13041`	PPR_2	79	111	1.7e-10	41.6
TkA07G171050	`PF01535`	PPR	80	109	3e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B59`	Arabidopsis thaliana	sp\|Q94B59\|PP372_ARATH Pentatricopeptide repeat-containing protein At5g09450, mitochondrial	60.400%	Swiss-Prot	High
`Q9SY07`	Arabidopsis thaliana	sp\|Q9SY07\|PP302_ARATH Pentatricopeptide repeat-containing protein At4g02820, mitochondrial	35.900%	Swiss-Prot	Medium
`Q93WC5`	Arabidopsis thaliana	sp\|Q93WC5\|PP300_ARATH Pentatricopeptide repeat-containing protein At4g01990, mitochondrial	29.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card