TkA07G154360 | RubberDandelionOmics

Gene overview

TkA07G154360

Reference: TK1151 Chr: Chr07 Coordinates: 39726404-39735497 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1441 bp · TkA07G154360|TK1151|cDNA

GAAGTCTACTCTCCAACTTCGTTGCCCGCTCCGAATCATGGCTGCCTCCATCTTGCCATCTGGTTACCAGCTATCGGCAGCCTCGCCGGACTGGCTAAACAAAGGAGACAACGCATGGCAGATGACCTCCGCCACCCTCGTCGGACTCCAAAGCGTGCCAGGCCTCGTCATCCTCTACGGCAGCATCGTTAAGAAGAAATGGGCGGTGAACTCGGCGTTCATGTCGCTGTACGCCTTCTCCGCCGTCGTCATCTGCTGGG...

CDS

Download CDS FASTA

1404 bp · TkA07G154360|TK1151|CDS

ATGGCTGCCTCCATCTTGCCATCTGGTTACCAGCTATCGGCAGCCTCGCCGGACTGGCTAAACAAAGGAGACAACGCATGGCAGATGACCTCCGCCACCCTCGTCGGACTCCAAAGCGTGCCAGGCCTCGTCATCCTCTACGGCAGCATCGTTAAGAAGAAATGGGCGGTGAACTCGGCGTTCATGTCGCTGTACGCCTTCTCCGCCGTCGTCATCTGCTGGGTGACTTGGGCCTACAAGATGTCCTTCGGCGAGAAGCT...

Protein

Download Protein FASTA

468 aa · TkA07G154360|TK1151|PROTEIN

MAASILPSGYQLSAASPDWLNKGDNAWQMTSATLVGLQSVPGLVILYGSIVKKKWAVNSAFMSLYAFSAVVICWVTWAYKMSFGEKLLPFWGKAGPALGQKFLIKQAALPASTHYHSNGELETAMIEPFYPMASMVWFQCVFAAIAVILLAGSLLGRMNIKAWMAFVPLWLTFSYTVGAFSLWGGGFLFHWGVMDYSGGYVIHLSSGVAGFTAAYWVGPRLTIDRERFPPNNVIMTLAGAGLLWMGWAGFNGGDPYSANI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G154360`
TK1151 ID	TkA07G154360
OH-1004 ID	LXL04_000028
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.700
Protein coverage (%)	TK1151 96.368 / OH-1004 92.418 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G154360

Location Chr07:39726404-39735497 (+)

Description Similar to AMT2: Ammonium transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38290`	High affinity ammonium transporter that may play an important role in moving ammonium between the apoplast and symplast of cells throughout the plant.	Characterization of Arabidopsis AtAMT2, a high-affinity ammonium transporter of the plasma membrane.2002 · DOI: 10.1104/pp.008599

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0870300`	Involved in ammonium transport.	No verified direct reference in this release
`Os02g0550800`	Involved in ammonium transport.	No verified direct reference in this release
`Os03g0838400`	Involved in ammonium transport.	No verified direct reference in this release
`Os01g0831300`	Involved in ammonium transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0072488 ammonium transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0008519 ammonium channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G38290

dosa:Os01g0831900

dosa:Os01g0870300

dosa:Os02g0550800

dosa:Os05g0468700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.807

Rank 1 · TkA07G154360 · TK1151

Cytoplasm0.123

Rank 2 · TkA07G154360 · TK1151

Lysosome / Vacuole0.064

Rank 3 · TkA07G154360 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA07G154360 · TK1151

Golgi apparatus0.038

Rank 5 · TkA07G154360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00909Ammonium_transp26-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G154360	`PF00909`	Ammonium_transp	26	450	1.1e-78	265.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M6N7`	Arabidopsis thaliana	sp\|Q9M6N7\|AMT2_ARATH Ammonium transporter 2	69.900%	Swiss-Prot	High
`Q84KJ6`	Oryza sativa subsp. japonica	sp\|Q84KJ6\|AMT31_ORYSJ Ammonium transporter 3 member 1	78.500%	Swiss-Prot	High
`Q69T29`	Oryza sativa subsp. japonica	sp\|Q69T29\|AMT33_ORYSJ Ammonium transporter 3 member 3	76.300%	Swiss-Prot	High
`Q851M9`	Oryza sativa subsp. japonica	sp\|Q851M9\|AMT32_ORYSJ Ammonium transporter 3 member 2	73.200%	Swiss-Prot	High
`Q8S233`	Oryza sativa subsp. japonica	sp\|Q8S233\|AMT23_ORYSJ Ammonium transporter 2 member 3	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card