TkA07G151500 | RubberDandelionOmics

Gene overview

TkA07G151500

Reference: TK1151 Chr: Chr07 Coordinates: 38959338-38959748 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA07G151500|TK1151|cDNA

ATGGATCCACTCTTCCATGTTCTCAACGTCCTCCCTTTCTCCTTCCTCCGGCCACCGCGCCTTCGCCTCAAACTCCCAACCATAACACTCCCTTCTCCTATGACCGTATTCTCGCTCGTCCTCCTCACCTACTTCATGGTTGTCTCCGGTGTTGTCTACGATGTCATTGTTGAGCCTCCAGGCATAGGATCGACTCAAGATCCGCGAACTGGCACCGTCCGAACCAGTTGTTTTCATGTCGGCAGAGTCAACGGGCAATA...

CDS

Download CDS FASTA

411 bp · TkA07G151500|TK1151|CDS

ATGGATCCACTCTTCCATGTTCTCAACGTCCTCCCTTTCTCCTTCCTCCGGCCACCGCGCCTTCGCCTCAAACTCCCAACCATAACACTCCCTTCTCCTATGACCGTATTCTCGCTCGTCCTCCTCACCTACTTCATGGTTGTCTCCGGTGTTGTCTACGATGTCATTGTTGAGCCTCCAGGCATAGGATCGACTCAAGATCCGCGAACTGGCACCGTCCGAACCAGTTGTTTTCATGTCGGCAGAGTCAACGGGCAATA...

Protein

Download Protein FASTA

136 aa · TkA07G151500|TK1151|PROTEIN

MDPLFHVLNVLPFSFLRPPRLRLKLPTITLPSPMTVFSLVLLTYFMVVSGVVYDVIVEPPGIGSTQDPRTGTVRTSCFHVGRVNGQYIIEGLSSGFMFVLGGTGIILMDLAVSPNRAKSLKISFAAAGSRLWLLPM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G151500`
TK1151 ID	TkA07G151500
OH-1004 ID	LXL04_028392
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 94.118 / OH-1004 84.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G151500`
Location	Chr07:38959338-38959748 (+)
Description	Similar to CG9662: Putative oligosaccharyltransferase complex subunit CG9662
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028392` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006487 protein N-linked glycosylation Biological Process GO:0009101 glycoprotein biosynthetic process Biological Process GO:0180058 protein co-translational transfer of dolichol-linked oligosaccharide Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0008250 oligosaccharyltransferase complex Cellular Component GO:0160226 oligosaccharyltransferase complex A Cellular Component GO:0030674 protein-macromolecule adaptor activity Molecular Function
KEGG gene cross-reference	dme:Dmel_CG9662 gga:422525 xla:444229 xla:496140 xtr:549410 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.329

Rank 1 · TkA07G151500 · TK1151

Golgi apparatus0.179

Rank 2 · TkA07G151500 · TK1151

Nucleus0.137

Rank 3 · TkA07G151500 · TK1151

Plastid0.135

Rank 4 · TkA07G151500 · TK1151

Cytoplasm0.134

Rank 5 · TkA07G151500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04756OST3_OST630-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G151500	`PF04756`	OST3_OST6	30	121	7e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card