TkA07G151180 | RubberDandelionOmics

Gene overview

TkA07G151180

Reference: TK1151 Chr: Chr07 Coordinates: 38894019-38895242 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · TkA07G151180|TK1151|cDNA

ATGAAATACCTAATTCACTATTCGTGTGATAGGCTAATTGAATGCACTAAGTGGTTCATGACTCTCACTTATAACATCCAGTCATCCACCCAAAGACTCCCACTTCCAATACTAAAAGTCATCAATCCGTGTGACCGCTATGCCAAAGATATCAATCGCTTCTCAATTCTCCCCAAATTCCAAACCCTAAAAACTCGATTTTCTGTTCCCATAAAATCGATGGCGCCAAAGGCAGAAAAGAAGCCCGCTGAAAAAAAGCC...

CDS

Download CDS FASTA

837 bp · TkA07G151180|TK1151|CDS

ATGAAATACCTAATTCACTATTCGTGTGATAGGCTAATTGAATGCACTAAGTGGTTCATGACTCTCACTTATAACATCCAGTCATCCACCCAAAGACTCCCACTTCCAATACTAAAAGTCATCAATCCGTGTGACCGCTATGCCAAAGATATCAATCGCTTCTCAATTCTCCCCAAATTCCAAACCCTAAAAACTCGATTTTCTGTTCCCATAAAATCGATGGCGCCAAAGGCAGAAAAGAAGCCCGCTGAAAAAAAGCC...

Protein

Download Protein FASTA

278 aa · TkA07G151180|TK1151|PROTEIN

MKYLIHYSCDRLIECTKWFMTLTYNIQSSTQRLPLPILKVINPCDRYAKDINRFSILPKFQTLKTRFSVPIKSMAPKAEKKPAEKKPAEEKKTPVAEKAPAEKKPKAGKKLPKEAGAAADKVTQARSMSLLSKPHEHLVYLTYNAIALTKLRRFSEAVAELDLVDKGLDIYRYETYPHHYPNRHGSMAPFVLRWLHAELPSRLGKRQETLDRFYLLLQFHIVVSLKKLCKFTGLRLTYSLLNDNLFDVLALNLNVSCLPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G151180`
TK1151 ID	TkA07G151180
OH-1004 ID	LXL04_028391
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G151180`
Location	Chr07:38894019-38895242 (+)
Description	Similar to Probable histone H2B.2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028391` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0000786 nucleosome Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0003677 DNA binding Molecular Function GO:0030527 structural constituent of chromatin Molecular Function GO:0046982 protein heterodimerization activity Molecular Function
KEGG gene cross-reference	ath:AT3G45980 mtr:11417139 mtr:11442767 mtr:25492748 sly:778282 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.411

Rank 1 · TkA07G151180 · TK1151

Nucleus0.353

Rank 2 · TkA07G151180 · TK1151

Mitochondrion0.163

Rank 3 · TkA07G151180 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA07G151180 · TK1151

Cell membrane0.069

Rank 5 · TkA07G151180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20069DUF646575-125 aa

PF13728TraF80-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G151180	`PF20069`	DUF6465	75	125	1.2	10.0
TkA07G151180	`PF13728`	TraF	80	169	0.01	16.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card