TkA07G148450 | RubberDandelionOmics

Gene overview

TkA07G148450

Reference: TK1151 Chr: Chr07 Coordinates: 38306628-38307546 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA07G148450|TK1151|cDNA

ATGTCTAAGGGCTTTTCTCTAGACAATGATCTTGTGAAAGCTGGTGTGGCAAATCAAACTACAATGTTGAGAGGAGAAACAGAGGATGAGAGACAAGATGTGATGTATAAATTTAATGATAAAAAACTAGATATTATGTTGGTAATTGGCGGGTGGAATTCAAGTAATACTTCACACCTTCAAGAAATTGCAGAGATTGCAGAGGGTCGTGGGATTCCATCTTATTGGATCGACATTGAGCAATGCGTGGGTCCCAGTAA...

CDS

Download CDS FASTA

441 bp · TkA07G148450|TK1151|CDS

ATGTCTAAGGGCTTTTCTCTAGACAATGATCTTGTGAAAGCTGGTGTGGCAAATCAAACTACAATGTTGAGAGGAGAAACAGAGGATGAGAGACAAGATGTGATGTATAAATTTAATGATAAAAAACTAGATATTATGTTGGTAATTGGCGGGTGGAATTCAAGTAATACTTCACACCTTCAAGAAATTGCAGAGATTGCAGAGGGTCGTGGGATTCCATCTTATTGGATCGACATTGAGCAATGCGTGGGTCCCAGTAA...

Protein

Download Protein FASTA

146 aa · TkA07G148450|TK1151|PROTEIN

MSKGFSLDNDLVKAGVANQTTMLRGETEDERQDVMYKFNDKKLDIMLVIGGWNSSNTSHLQEIAEIAEGRGIPSYWIDIEQCVGPSNQITYKLMHGELVEKENWLPKGHLTIGVTSGSSTLNKVVEDVLLRVFEIKCEDAIQLAWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G148450`
TK1151 ID	TkA07G148450
OH-1004 ID	LXL04_038308
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.900
Protein coverage (%)	TK1151 98.630 / OH-1004 38.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G148450

Location Chr07:38306628-38307546 (-)

Description Similar to ISPH: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34350`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).	Characterization of the Arabidopsis clb6 mutant illustrates the importance of posttranscriptional regulation of the methyl-D-erythritol 4-phosphate pathway.2005 · DOI: 10.1105/tpc.104.028860 The Arabidopsis IspH homolog is involved in the plastid nonmevalonate pathway of isoprenoid biosynthesis.2005 · DOI: 10.1104/pp.104.058735

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0731900`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038308 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0050992 dimethylallyl diphosphate biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0046429 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity (ferredoxin) Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

GO:0051745 4-hydroxy-3-methylbut-2-enyl diphosphate reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G34350

ava:Ava_2949

cyn:Cyan7425_2354

dosa:Os03g0731900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · TkA07G148450 · TK1151

Nucleus0.260

Rank 2 · TkA07G148450 · TK1151

Extracellular0.103

Rank 3 · TkA07G148450 · TK1151

Mitochondrion0.067

Rank 4 · TkA07G148450 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA07G148450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02401LYTB13-28 aa

PF00365PFK26-59 aa

PF02401LYTB29-130 aa

PF00365PFK107-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G148450	`PF02401`	LYTB	13	28	1.1e-16	61.6
TkA07G148450	`PF00365`	PFK	26	59	0.027	14.5
TkA07G148450	`PF02401`	LYTB	29	130	1.1e-16	61.6
TkA07G148450	`PF00365`	PFK	107	125	0.027	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B35`	Arabidopsis thaliana	sp\|Q94B35\|ISPH_ARATH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic	55.900%	Swiss-Prot	High
`Q6AVG6`	Oryza sativa subsp. japonica	sp\|Q6AVG6\|ISPH_ORYSJ 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card