TkA07G144620 | RubberDandelionOmics

Gene overview

TkA07G144620

Reference: TK1151 Chr: Chr07 Coordinates: 37350422-37355190 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

760 bp · TkA07G144620|TK1151|cDNA

ATCTAAAGAGCAAAAGTTGTATGACAAAAATAGTCCGAAAGAAAAGAATGGATAAACATGATGACTCGTAAAAAATGTTTAAAAAAGATAAAACAAAAGACATGGTCTAGCGGGGTCTGCTTGGCCACTGCCGAAACTACCACCGTTTCTCGTCCTCAGACCGTTCCATTCCAGCTTCGTTCAAGATGACCACTGCCACCACCGCCGCTAGTCGTTACGTCTTTCTCGGTGTGGACGTTGGCACTGGTAGCGCTCGCGCA...

CDS

Download CDS FASTA

735 bp · TkA07G144620|TK1151|CDS

ATGACCACTGCCACCACCGCCGCTAGTCGTTACGTCTTTCTCGGTGTGGACGTTGGCACTGGTAGCGCTCGCGCAGGACTTTTTGATCAAGATGGGAAGCTTCTGGGTTCTGCTAGCAGCCCAATCCAAATTTGGAAAGAAGGCGACTGTGTTGAGCAATCTTCAACTGATATTTGGCTTGCAATCTGCACTGCTGTTAAAAGAGCTTTATCACTTGCCAATGTTGCTGGTGAAGAAGTAAGTGGATTAGGTTTTGCAGC...

Protein

Download Protein FASTA

244 aa · TkA07G144620|TK1151|PROTEIN

MTTATTAASRYVFLGVDVGTGSARAGLFDQDGKLLGSASSPIQIWKEGDCVEQSSTDIWLAICTAVKRALSLANVAGEEVSGLGFAATCSLVAVDSEGQPVTVSLSGDTRRNVIVWMDHRAVMQAEKINACNSPVLQYCGGSISPEMQPPKLLWVKENLAESWLMTWRWMDLSDWLSYRATGDDTRSMCTTVCKWTYLGHAHMQHVNDEGRSRKKHGWKHVDGRMMTFGKRLGYVTLLTTIIPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G144620`
TK1151 ID	TkA07G144620
OH-1004 ID	LXL04_028338
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.600
Protein coverage (%)	TK1151 89.344 / OH-1004 37.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G144620`
Location	Chr07:37350422-37355190 (-)
Description	Similar to Fggy: FGGY carbohydrate kinase domain-containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028338` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0019321 pentose metabolic process Biological Process GO:0046835 carbohydrate phosphorylation Biological Process GO:0070050 neuron cellular homeostasis Biological Process GO:0005737 cytoplasm Cellular Component GO:0019150 D-ribulokinase activity Molecular Function
KEGG gene cross-reference	hsa:55277 mmu:75578 sce:YDR109C xla:447059 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.344

Rank 1 · TkA07G144620 · TK1151

Mitochondrion0.282

Rank 2 · TkA07G144620 · TK1151

Peroxisome0.189

Rank 3 · TkA07G144620 · TK1151

Plastid0.161

Rank 4 · TkA07G144620 · TK1151

Nucleus0.130

Rank 5 · TkA07G144620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00370FGGY_N13-187 aa

PF01869BcrAD_BadFG14-40 aa

PF04984Phage_sheath_169-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G144620	`PF00370`	FGGY_N	13	187	1.2e-17	65.0
TkA07G144620	`PF01869`	BcrAD_BadFG	14	40	0.14	12.4
TkA07G144620	`PF04984`	Phage_sheath_1	69	130	0.24	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card