TkA07G144610 | RubberDandelionOmics

Gene overview

TkA07G144610

Reference: TK1151 Chr: Chr07 Coordinates: 37344661-37348642 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · TkA07G144610|TK1151|cDNA

ACCCAATCAGAACCTCCGTAACTGTCAGTGAAAACAAGCTCAATTTTTCGTATTAAGACTACCTCTCGGAAATGGCCTCCGTTGCACCGCTCCTTCCGCCACCCCTCCGCACCCTCACCATCCGCCCCTCAACCGACGCGCATGAGACTCATTTCCTCAGTAAATCATCTTCATCACCTCGTCTTGCTAGTTCTCCGTCCGGAATGCCTCTCCGACAGCTCGCGCAAGTTAGTTATGAAGGTGAAAGAGAAGCTTGAGAA...

CDS

Download CDS FASTA

741 bp · TkA07G144610|TK1151|CDS

ATGAGACTCATTTCCTCAGTAAATCATCTTCATCACCTCGTCTTGCTAGTTCTCCGTCCGGAATGCCTCTCCGACAGCTCGCGCAAGTTAGTTATGAAGGTGAAAGAGAAGCTTGAGAAAGACCATTTCAGTCTTCCTACAGGAAAAAATGGAAGAGATGATGAGGATATGATTCTATGGTACTTAAAAGACAGGCGCTTTTCAGTAGAAGAGGCTATTTCTAAACTCACCAAAACAATTAAATGGCGACATGAATTTGG...

Protein

Download Protein FASTA

246 aa · TkA07G144610|TK1151|PROTEIN

MRLISSVNHLHHLVLLVLRPECLSDSSRKLVMKVKEKLEKDHFSLPTGKNGRDDEDMILWYLKDRRFSVEEAISKLTKTIKWRHEFGVSELTEESVRRVYATGKSYVHDSLDVNGRPVLVVVPAKHTPDMFDRIEDERLCVFLLEKAISRLPEGKEEILGIFDLRGFGTKNADLKFLTFFFEVLYYHYPQRVGQVLFIDAPYIFQPIWQLAKPLIKHYASLARFCSVEDVRKEYFTESTVPPSFRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G144610`
TK1151 ID	TkA07G144610
OH-1004 ID	LXL04_028337
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 90.650 / OH-1004 83.942 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G144610`
Location	Chr07:37344661-37348642 (-)
Description	Similar to pitC: Phosphatidylinositol transfer protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028337` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006935 chemotaxis Biological Process GO:0015914 phospholipid transport Biological Process GO:0051260 protein homooligomerization Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:0140042 lipid droplet formation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component GO:0044232 organelle membrane contact site Cellular Component
KEGG gene cross-reference	ddi:DDB_G0269182 hsa:158747 mmu:76763 spo:2539120 spo:2543637 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · TkA07G144610 · TK1151

Endoplasmic reticulum0.189

Rank 2 · TkA07G144610 · TK1151

Mitochondrion0.181

Rank 3 · TkA07G144610 · TK1151

Nucleus0.129

Rank 4 · TkA07G144610 · TK1151

Cell membrane0.111

Rank 5 · TkA07G144610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16433DUF50303-39 aa

PF00650CRAL_TRIO48-96 aa

PF00650CRAL_TRIO102-220 aa

PF13716CRAL_TRIO_2115-201 aa

PF16433DUF5030135-165 aa

PF16433DUF5030202-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G144610	`PF16433`	DUF5030	3	39	0.35	10.9
TkA07G144610	`PF00650`	CRAL_TRIO	48	96	2.4e-25	89.8
TkA07G144610	`PF00650`	CRAL_TRIO	102	220	2.4e-25	89.8
TkA07G144610	`PF13716`	CRAL_TRIO_2	115	201	6.4e-07	30.5
TkA07G144610	`PF16433`	DUF5030	135	165	0.35	10.9
TkA07G144610	`PF16433`	DUF5030	202	226	0.35	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card