TkA07G137900 | RubberDandelionOmics

Gene overview

TkA07G137900

Reference: TK1151 Chr: Chr07 Coordinates: 35696013-35700605 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1922 bp · TkA07G137900|TK1151|cDNA

CGACAACTTCCTCGCATGGACGTCTTCCTCGTTTTTTTTTTTTGGAACGACAAGAAACGTCTTCCTCGTTTCTTCCTCTGTGTCGCGACCTCCACACAGCTTCTTCTCGGCCGACATCCAGGTTCCGGTTTAACTTTTTGGTGTCATTAATTCAGTAATGAGAAAGCGAACAAATCCTGCTGACCTGGCACAAGGAGATGGAGTCTCAGATCTCAAATCTTCACAAGAAGAAAGAAAGCAAAAAGCCAATCAATTTCCAT...

CDS

Download CDS FASTA

1590 bp · TkA07G137900|TK1151|CDS

ATGAGAAAGCGAACAAATCCTGCTGACCTGGCACAAGGAGATGGAGTCTCAGATCTCAAATCTTCACAAGAAGAAAGAAAGCAAAAAGCCAATCAATTTCCATCATCCAAGAAAATCTTTTTAATTTGTTTAATTTTCAGAATGACAAATTCTTTATTTGTGCAAACATATTTCAACCCAGATGAGCACTGGCAAGCACTTGAAGTTGCACATCGAATTACCTTCGGATACGGACATTTAACATGGGAGTGGACAAAAGG...

Protein

Download Protein FASTA

529 aa · TkA07G137900|TK1151|PROTEIN

MRKRTNPADLAQGDGVSDLKSSQEERKQKANQFPSSKKIFLICLIFRMTNSLFVQTYFNPDEHWQALEVAHRITFGYGHLTWEWTKGIRSYFHPMLFAILYKLLSLLHLDTPLFMIKSPRLLQSMLSAFGDLYMFKLSHAMYGGHVAQWVLFAQLTNWFMFYCMTRTLSNSLETVLTVVSLYYWPSLRSKMTDLPLGSRTWGLVAGGLACAIRPTSAIIWVYVGIIELFGSHNRLKFVFLEVVPIGCIVVGVTLIVDRLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G137900`
TK1151 ID	TkA07G137900
OH-1004 ID	LXL04_028278
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 99.433 / OH-1004 99.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G137900

Location Chr07:35696013-35700605 (-)

Description Similar to Pigb: GPI mannosyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14850`	Mannosyltransferase involved in glycosylphosphatidylinositol- anchor biosynthesis.	ABNORMAL POLLEN TUBE GUIDANCE1, an Endoplasmic Reticulum-Localized Mannosyltransferase Homolog of GLYCOSYLPHOSPHATIDYLINOSITOL10 in Yeast and PHOSPHATIDYLINOSITOL GLYCAN ANCHOR BIOSYNTHESIS B in Human, Is Required for Arabidopsis Pollen Tube Micropylar Guidance and Embryo Development.2014 · DOI: 10.1104/pp.114.236133

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028278 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006505 GPI anchor metabolic process Biological Process

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0016255 attachment of GPI anchor to protein Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT5G14850

bta:616044

hsa:9488

mmu:55981

xla:734564

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.885

Rank 1 · TkA07G137900 · TK1151

Nucleus0.062

Rank 2 · TkA07G137900 · TK1151

Cytoplasm0.048

Rank 3 · TkA07G137900 · TK1151

Cell membrane0.040

Rank 4 · TkA07G137900 · TK1151

Golgi apparatus0.040

Rank 5 · TkA07G137900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03901Glyco_transf_2239-435 aa

PF04123DUF373151-178 aa

PF04123DUF373320-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G137900	`PF03901`	Glyco_transf_22	39	435	1.3e-119	400.8
TkA07G137900	`PF04123`	DUF373	151	178	0.062	13.4
TkA07G137900	`PF04123`	DUF373	320	419	0.062	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A15`	Arabidopsis thaliana	sp\|Q94A15\|APTG1_ARATH Mannosyltransferase APTG1	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card