TkA07G136920 | RubberDandelionOmics

Gene overview

TkA07G136920

Reference: TK1151 Chr: Chr07 Coordinates: 35449054-35450868 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1590 bp · TkA07G136920|TK1151|cDNA

TACAGTGCCCTATATCCCCCGATTCATCTCTACGCTTCACCCCGATTCATCTCTAGGACTCTACCTCCACCGGCGACTTCAAAGCTTCCAATTCTCACCGGCGACTTCACAGCTTCCATCACCCGACGGCGCCTTCTCCAGGTGGTTCCCTCTCCACCGACGACGCCCTCTCCAGCGCCGGCGACTTCACAATTCCTCTCATTGTCGCCTTTTGGAACCCTAACCTTCTCTCCGTTAACAATGAAGTTCAAGCTGCGGGT...

CDS

Download CDS FASTA

1401 bp · TkA07G136920|TK1151|CDS

TACAGTGCCCTATATCCCCCGATTCATCTCTACGCTTCACCCCGATTCATCTCTAGGACTCTACCTCCACCGGCGACTTCAAAGCTTCCAATTCTCACCGGCGACTTCACAGCTTCCATCACCCGACGGCGCCTTCTCCAGGTGGTTCCCTCTCCACCGACGACGCCCTCTCCAGCGCCGGCGACTTCACAATTCCTCTCATTGTCGCCTTTTGGAACCCTAACCTTCTCTCCGTTAACAATGAAGTTCAAGCTGCGGGT...

Protein

Download Protein FASTA

466 aa · TkA07G136920|TK1151|PROTEIN

YSALYPPIHLYASPRFISRTLPPPATSKLPILTGDFTASITRRRLLQVVPSPPTTPSPAPATSQFLSLSPFGTLTFSPLTMKFKLRVMDADAQRHQNHIYHSQSSSSSSPYTYFTEQPIRGFPTGNFSGGHGGPEMFRERFDMRDAIHRELEKERIREAIIAEEMARKRILEEEVRHELMMEWEMAAIRNVGGFPPPYFPVPLPPTHNHLLEPVILHRQPIGLEERIIMSIEEKNSRSGGGGGGGGGFHPPEIRVLDSPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G136920`
TK1151 ID	TkA07G136920
OH-1004 ID	LXL04_008318
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.500
Protein coverage (%)	TK1151 9.442 / OH-1004 17.460 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G136920`
Location	Chr07:35449054-35450868 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008318` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA07G136920 · TK1151

Cytoplasm0.097

Rank 2 · TkA07G136920 · TK1151

Cell membrane0.036

Rank 3 · TkA07G136920 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA07G136920 · TK1151

Plastid0.019

Rank 5 · TkA07G136920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18868zf-C2H2_3rep159-176 aa

PF23320Zn_SUZ12285-313 aa

PF12756zf-C2H2_2286-319 aa

PF12874zf-met293-317 aa

PF12171zf-C2H2_jaz293-318 aa

PF23107Zf-C2H2_ZNF451_C293-332 aa

PF25095C2H2-zf_KIN17293-318 aa

PF18868zf-C2H2_3rep295-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G136920	`PF18868`	zf-C2H2_3rep	159	176	3.0	9.2
TkA07G136920	`PF23320`	Zn_SUZ12	285	313	0.013	15.9
TkA07G136920	`PF12756`	zf-C2H2_2	286	319	0.0027	18.6
TkA07G136920	`PF12874`	zf-met	293	317	3.7e-14	53.2
TkA07G136920	`PF12171`	zf-C2H2_jaz	293	318	1e-06	29.5
TkA07G136920	`PF23107`	Zf-C2H2_ZNF451_C	293	332	0.032	15.5
TkA07G136920	`PF25095`	C2H2-zf_KIN17	293	318	0.93	10.5
TkA07G136920	`PF18868`	zf-C2H2_3rep	295	407	3.0	9.2
TkA07G136920	`PF10176`	NEDD4_Bsd2	325	403	0.074	14.1
TkA07G136920	`PF23320`	Zn_SUZ12	390	409	0.013	15.9
TkA07G136920	`PF12756`	zf-C2H2_2	400	426	0.0027	18.6
TkA07G136920	`PF12874`	zf-met	401	425	3.7e-14	53.2
TkA07G136920	`PF12171`	zf-C2H2_jaz	401	425	1e-06	29.5
TkA07G136920	`PF23107`	Zf-C2H2_ZNF451_C	401	421	0.032	15.5
TkA07G136920	`PF25095`	C2H2-zf_KIN17	401	407	0.93	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card