TkA07G134340 | RubberDandelionOmics

Gene overview

TkA07G134340

Reference: TK1151 Chr: Chr07 Coordinates: 34891337-34893427 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1258 bp · TkA07G134340|TK1151|cDNA

CCACCTCGGCTCCTTCGACGACGTTTAAGCCCCATACCGACCAGCCTTAATAACCGTCAGACTCTCGTGTCTCTCCCACTCACTCGCTGAACCGACGACGACACACGCCGCACAGGAACAGGTGCACAGCAACCTCACCGGCGACTCACGGCCGACTACCTGCTCCGAGACTCCGAGCCCTAGGCTACTGCGTGCGACCACATGCTTCGAGCCGTCGATACCTGATTCCTGAAAACCCTAGGCTCCGAGCCTCCGATTGT...

CDS

Download CDS FASTA

570 bp · TkA07G134340|TK1151|CDS

ATGGTGGTGGCTTCTGGTAACTCCTTCGCCAAGGAGATGACCATTAGAAAACGTATCGGCAACATATTCAATAAAAGGGTGGAAGATTTTCCATCATTAAGAGAGTATAACGACTACTTAGAGGAAGTTGAGGACATGATTGTAAACTTGGTTGAAGGAATAGACGTTCCCGCCATTGAAGCAAAGATCGCATACTACCAAAAAGAAAATGCAGAACAAATAATGAATGCTCAAGCCCGTAAAGCTGAAGAATATGCAGC...

Protein

Download Protein FASTA

189 aa · TkA07G134340|TK1151|PROTEIN

MVVASGNSFAKEMTIRKRIGNIFNKRVEDFPSLREYNDYLEEVEDMIVNLVEGIDVPAIEAKIAYYQKENAEQIMNAQARKAEEYAAALAASKGQPPQTDVDMTSGTGSQFGVSTTDGHYVPAVAGGTIPQPRPTQPLPVGSADDMHAYHMDDEEMMRLKAERGGKAGGWSLELSRKRALEEAFGSIWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G134340`
TK1151 ID	TkA07G134340
OH-1004 ID	LXL04_028256
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G134340`
Location	Chr07:34891337-34893427 (+)
Description	Similar to mnat1: CDK-activating kinase assembly factor MAT1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028256` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0001174 transcriptional start site selection at RNA polymerase II promoter Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0048661 positive regulation of smooth muscle cell proliferation Biological Process GO:0051301 cell division Biological Process GO:0051592 response to calcium ion Biological Process GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process
KEGG gene cross-reference	hsa:4331 mmu:17420 sce:YDR460W xla:380053 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.800

Rank 1 · TkA07G134340 · TK1151

Cytoplasm0.321

Rank 2 · TkA07G134340 · TK1151

Cell membrane0.029

Rank 3 · TkA07G134340 · TK1151

Mitochondrion0.027

Rank 4 · TkA07G134340 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA07G134340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06391MAT111-88 aa

PF06810Phage_scaffold35-91 aa

PF04538BEX36-45 aa

PF04538BEX67-159 aa

PF25811CAK-anch_MAT1162-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G134340	`PF06391`	MAT1	11	88	5.8e-29	102.1
TkA07G134340	`PF06810`	Phage_scaffold	35	91	0.12	13.0
TkA07G134340	`PF04538`	BEX	36	45	0.11	13.9
TkA07G134340	`PF04538`	BEX	67	159	0.11	13.9
TkA07G134340	`PF25811`	CAK-anch_MAT1	162	185	0.03	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card