TkA07G132540 | RubberDandelionOmics

Gene overview

TkA07G132540

Reference: TK1151 Chr: Chr07 Coordinates: 34378706-34382405 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2209 bp · TkA07G132540|TK1151|cDNA

AAGAGATCAATGGTTATTGAACTCCAAATCTATTGAATGCCAATATATCCCAGAGAACTAGACTCGCAAAGTCTCCCATGACCTCGTCGCAAAGTCTCACATGACCTGCAATAAACACACAAAAACAGGTCTCGAAATTTCAGTTCTGATAAACTTTCAGCCAAACCAACAGCGAATCCATCTTTGATTTCTTGAATTCAGAAAAGGGTTGCCGGAGAATCTTAAAATCCCGATGACTATCGGAGCTGGTTCGGAGAAAA...

CDS

Download CDS FASTA

1317 bp · TkA07G132540|TK1151|CDS

ATGACTATCGGAGCTGGTTCGGAGAAAATGAATCTATCTGTGAAGGAATCAGTGATGGTCAAACCATCCAAACCAACGCCGACTCAGCGACTATGGAACTCGAATCTCGATTTAATCGTGGGTCGGATCCATTTATTGACCATTTACTTTTACAGGTCAAATGGGTCCTCGAACTTCTTTGATTCGGTGGTTCTAAAACAGGCTCTCTCCGACGTTCTTTGTTCCTTTTATCCAATGGCCGGACGGCTGGGTTCCGATGG...

Protein

Download Protein FASTA

438 aa · TkA07G132540|TK1151|PROTEIN

MTIGAGSEKMNLSVKESVMVKPSKPTPTQRLWNSNLDLIVGRIHLLTIYFYRSNGSSNFFDSVVLKQALSDVLCSFYPMAGRLGSDGDGRVEIDCNGKGVLFVEAEADFTIDDFGEITPSPELRRLAPTVDYSGDISSYPLFITQVTRFKCGGVSLGCGVHHTLSDGFSSLHFINTWSDIARGLSIKIPPFNDRTLLRARDPPTPMFDHIEYHPPPLLITRAENHKPTPSTTILRLTLNQINDLKSKGKGDGSVYHSTFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G132540`
TK1151 ID	TkA07G132540
OH-1004 ID	LXL04_028234
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.397 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G132540

Location Chr07:34378706-34382405 (-)

Description Similar to HST: Shikimate O-hydroxycinnamoyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48930`	Acyltransferase involved in the biosynthesis of lignin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0500700`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to various acyl acceptors.	No verified direct reference in this release
`Os02g0611800`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to various acyl acceptors.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028234 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0047172 shikimate O-hydroxycinnamoyltransferase activity Molecular Function

GO:0047205 quinate O-hydroxycinnamoyltransferase activity Molecular Function

GO:0050266 rosmarinate synthase activity Molecular Function

GO:0050734 hydroxycinnamoyltransferase activity Molecular Function

KEGG gene cross-reference

ag:QDC27803

ath:AT5G48930

dosa:Os04g0500700

nta:107796658

osa:4336306

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.670

Rank 1 · TkA07G132540 · TK1151

Nucleus0.244

Rank 2 · TkA07G132540 · TK1151

Endoplasmic reticulum0.108

Rank 3 · TkA07G132540 · TK1151

Plastid0.088

Rank 4 · TkA07G132540 · TK1151

Cell membrane0.068

Rank 5 · TkA07G132540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase11-435 aa

PF16911PapA_C229-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G132540	`PF02458`	Transferase	11	435	5e-111	372.2
TkA07G132540	`PF16911`	PapA_C	229	335	0.027	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI78`	Arabidopsis thaliana	sp\|Q9FI78\|HST_ARATH Shikimate O-hydroxycinnamoyltransferase	56.500%	Swiss-Prot	High
`Q0JBZ8`	Oryza sativa subsp. japonica	sp\|Q0JBZ8\|HCT1_ORYSJ Hydroxycinnamoyltransferase 1	54.300%	Swiss-Prot	High
`Q6K638`	Oryza sativa subsp. japonica	sp\|Q6K638\|HCT2_ORYSJ Hydroxycinnamoyltransferase 2	52.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card