TkA07G129020 | RubberDandelionOmics

Gene overview

TkA07G129020

Reference: TK1151 Chr: Chr07 Coordinates: 33340516-33344434 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA07G129020|TK1151|cDNA

CTATAAAGATCACAAACTATATAATATGTTTTGGGTTGCACAGTAAACTACTCATTGATTTCACGCCACTTTAGTTCTGGTGTACAACCACAATATGAAAGATCTTCATCTGAGGATCAAGTGGATCCCTTTTCTCTAGTTGCTGATGAACTATCAGTTGTTGCTAATAGGTTGCGAGCAATGGTGGTTGCTGAGGTGCCAAAACTTGCATCAGCAGCCGAGTATTTCTTTAAGATGGGTGTTGAAGGGAAGAGGTTTCG...

CDS

Download CDS FASTA

966 bp · TkA07G129020|TK1151|CDS

ATGGTGGTTGCTGAGGTGCCAAAACTTGCATCAGCAGCCGAGTATTTCTTTAAGATGGGTGTTGAAGGGAAGAGGTTTCGCCCCACTGTTATTTTATTAATGGCAACAGCTTTAAATGTTCAAATCTCCAAACCGGCATCAGAAGGGGTGGTTGATATGTTCTCAACAGAGTTGCGTTTAAGACAACAATCGATTGCTGAAATCACAGAGATGATTCATGTTGCCAGCCTCCTTCATGATGATGTACTTGATGATGCTGA...

Protein

Download Protein FASTA

321 aa · TkA07G129020|TK1151|PROTEIN

MVVAEVPKLASAAEYFFKMGVEGKRFRPTVILLMATALNVQISKPASEGVVDMFSTELRLRQQSIAEITEMIHVASLLHDDVLDDADTRRGIGSLNYVMGNKLAVLAGDFLLSRACITLASLKNTEVVSLIATAVEHLVTGETMQMSTSAEQRTSMDYYLQKTYYKTASLISNSCKSIALLTGQTAEVAMLAYEYGKNLGLAFQLIDDVLDFTGTSSSLGKGALSDIHHGIITAPILYAMEEFPELRTVVDRGLEDPANV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G129020`
TK1151 ID	TkA07G129020
OH-1004 ID	LXL04_028201
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 71.175 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G129020

Location Chr07:33340516-33344434 (-)

Description Similar to SPS3: Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34630`	May be involved in the supply of solanesyl diphosphate for ubiquinone-9 (UQ-9) biosynthesis in mitochondria.	Gene network reconstruction identifies the authentic trans-prenyl diphosphate synthase that makes the solanesyl moiety of ubiquinone-9 in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04796.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0678200`	Involved in the supply of solanesyl diphosphate for ubiquinone-9 (UQ-9) biosynthesis in mitochondria.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028201 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0046165 alcohol biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032476 polyprenyl diphosphate synthase complex Cellular Component

KEGG gene cross-reference

ath:AT2G34630

dosa:Os06g0678200

mmu:56075

ncr:NCU02305

yli:2909963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · TkA07G129020 · TK1151

Nucleus0.356

Rank 2 · TkA07G129020 · TK1151

Cell membrane0.099

Rank 3 · TkA07G129020 · TK1151

Lysosome / Vacuole0.094

Rank 4 · TkA07G129020 · TK1151

Mitochondrion0.084

Rank 5 · TkA07G129020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00348polyprenyl_synt8-263 aa

PF07307HEPPP_synt_168-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G129020	`PF00348`	polyprenyl_synt	8	263	2.5e-67	227.5
TkA07G129020	`PF07307`	HEPPP_synt_1	68	180	0.058	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5HZ00`	Arabidopsis thaliana	sp\|Q5HZ00\|SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial	76.000%	Swiss-Prot	High
`Q653T6`	Oryza sativa subsp. japonica	sp\|Q653T6\|SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial	75.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card