TkA07G126650 | RubberDandelionOmics

Gene overview

TkA07G126650

Reference: TK1151 Chr: Chr07 Coordinates: 32735827-32736318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA07G126650|TK1151|cDNA

ATGATCTCACCAGAAAACGATGGGTTTCTCACAAGGTGTTTGGAAGGAAAGAAAGCCATAGACGTCAGACTTGCCGCCATTGCTGTCGGCACCTCCGCTCGCGGCGGATTTAGCAAGCTTTCGATCAGGGCAACCAACAAAGTCACTAAAACTGGATTCACAGCCATTGCACGTGGGCGCCCTTCGCTTAAAGTTCTTTCTCTGTGGAACTTACCTTCAATCGGGGATGAATCTTTAATCGAGATCGCTAAAGAATGCCA...

CDS

Download CDS FASTA

450 bp · TkA07G126650|TK1151|CDS

ATGATCTCACCAGAAAACGATGGGTTTCTCACAAGGTGTTTGGAAGGAAAGAAAGCCATAGACGTCAGACTTGCCGCCATTGCTGTCGGCACCTCCGCTCGCGGCGGATTTAGCAAGCTTTCGATCAGGGCAACCAACAAAGTCACTAAAACTGGATTCACAGCCATTGCACGTGGGCGCCCTTCGCTTAAAGTTCTTTCTCTGTGGAACTTACCTTCAATCGGGGATGAATCTTTAATCGAGATCGCTAAAGAATGCCA...

Protein

Download Protein FASTA

149 aa · TkA07G126650|TK1151|PROTEIN

MISPENDGFLTRCLEGKKAIDVRLAAIAVGTSARGGFSKLSIRATNKVTKTGFTAIARGRPSLKVLSLWNLPSIGDESLIEIAKECHSSEKLDPSHCPSISNKGVSAIGRHCPNLQSIIINDCPFVGDQGVATLLSSSPSSSLKKVRLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G126650`
TK1151 ID	TkA07G126650
OH-1004 ID	LXL04_005314
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.600
Protein coverage (%)	TK1151 61.074 / OH-1004 18.958 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G126650

Location Chr07:32735827-32736318 (+)

Description Similar to EBF1: EIN3-binding F-box protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25350`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1
`At2g25490`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005314 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT2G25490

ath:AT4G15475

ath:AT5G25350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.608

Rank 1 · TkA07G126650 · TK1151

Cytoplasm0.254

Rank 2 · TkA07G126650 · TK1151

Cell membrane0.078

Rank 3 · TkA07G126650 · TK1151

Plastid0.062

Rank 4 · TkA07G126650 · TK1151

Endoplasmic reticulum0.030

Rank 5 · TkA07G126650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25372LRR_FBXL1514-89 aa

PF12799LRR_440-50 aa

PF13516LRR_646-57 aa

PF29594LRR_SKP252-135 aa

PF26020LRR_1661-85 aa

PF12799LRR_461-74 aa

PF13516LRR_662-68 aa

PF13516LRR_674-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G126650	`PF25372`	LRR_FBXL15	14	89	2.2e-08	33.7
TkA07G126650	`PF12799`	LRR_4	40	50	0.15	13.1
TkA07G126650	`PF13516`	LRR_6	46	57	9.6e-05	22.9
TkA07G126650	`PF29594`	LRR_SKP2	52	135	0.054	13.5
TkA07G126650	`PF26020`	LRR_16	61	85	0.0059	16.8
TkA07G126650	`PF12799`	LRR_4	61	74	0.15	13.1
TkA07G126650	`PF13516`	LRR_6	62	68	9.6e-05	22.9
TkA07G126650	`PF13516`	LRR_6	74	83	9.6e-05	22.9
TkA07G126650	`PF25372`	LRR_FBXL15	91	147	2.2e-08	33.7
TkA07G126650	`PF13516`	LRR_6	95	108	9.6e-05	22.9
TkA07G126650	`PF12799`	LRR_4	107	126	0.15	13.1
TkA07G126650	`PF13516`	LRR_6	111	134	9.6e-05	22.9
TkA07G126650	`PF26020`	LRR_16	113	136	0.0059	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q708Y0`	Arabidopsis thaliana	sp\|Q708Y0\|EBF2_ARATH EIN3-binding F-box protein 2	61.600%	Swiss-Prot	Low
`Q9SKK0`	Arabidopsis thaliana	sp\|Q9SKK0\|EBF1_ARATH EIN3-binding F-box protein 1	61.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card