TkA07G123100 | RubberDandelionOmics

Gene overview

TkA07G123100

Reference: TK1151 Chr: Chr07 Coordinates: 31923662-31927057 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2037 bp · TkA07G123100|TK1151|cDNA

TATAAAATGAAATGGGTAGTACATTATCATTCATCGTGTATCCAAATTTGTTACACATTAAGGATTTCTATGTTCATTTAAATTTTCAGAAAAAAAATCAAAAAATGATTATATATGGTAAAAACAAAACGATAAATTACGCTCTTGAGTATTTAGATGTTCGGTAAAATGAACAAAGGCCCAAACCAAAATATTAAGCATAGCCCTGCACATTATTCAAAAACAGAATTAACTAGCACATTTGACCAAATCCCAGTCAA...

CDS

Download CDS FASTA

1473 bp · TkA07G123100|TK1151|CDS

ATGCATTATTTTTCTGCATTCTTGAAGAAAAACCCAAAGTTCTACACTACTCATCGGGCTCTCACCTCTCAATGCCATGGTCCCACCCACCACGCTCATTTGATCCCTACAAATTCTATCAACCAATCATCATCATATCCACCATCATCCTCAAAACTGAACAACACCAGATGGAATGGTTATGATCGTTATAAAAAGCTCGAATCATTGACGTCTAGTGTTGTTGTGGTCGGATTGAGCCTCGGGCTTTGTTACTTTGG...

Protein

Download Protein FASTA

490 aa · TkA07G123100|TK1151|PROTEIN

MHYFSAFLKKNPKFYTTHRALTSQCHGPTHHAHLIPTNSINQSSSYPPSSSKLNNTRWNGYDRYKKLESLTSSVVVVGLSLGLCYFGSVSQPNLQFAFADSEPHDQSKKLDKKPTYIFGDGYRRKVFFKYEKRIRTQSPPEKVFEYFASHQSPNGELFMTPADLMRAVVPVFTPSEATRVREGNLKGEEAPSELQCSPSKFFMLFDTNNDGLISFAEYIFFVTLLSIPESSFSIAFKMFDLDNNGEIDKEEFKKVMALMR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G123100`
TK1151 ID	TkA07G123100
OH-1004 ID	LXL04_028105
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G123100

Location Chr07:31923662-31927057 (+)

Description Similar to MICU: Calcium uptake protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32060`	Calcium-binding protein maintaining matrix calcium levels at low concentration.	The EF-Hand Ca2+ Binding Protein MICU Choreographs Mitochondrial Ca2+ Dynamics in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028105 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0006952 defense response Biological Process

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0051561 positive regulation of mitochondrial calcium ion concentration Biological Process

GO:0051562 negative regulation of mitochondrial calcium ion concentration Biological Process

GO:0070509 calcium ion import Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:0072732 cellular response to calcium ion starvation Biological Process

GO:1900069 regulation of cellular hyperosmotic salinity response Biological Process

KEGG gene cross-reference

ath:AT4G32060

hsa:10367

mcf:101866256

mmu:216001

xtr:100127574

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.873

Rank 1 · TkA07G123100 · TK1151

Cytoplasm0.069

Rank 2 · TkA07G123100 · TK1151

Plastid0.060

Rank 3 · TkA07G123100 · TK1151

Nucleus0.051

Rank 4 · TkA07G123100 · TK1151

Cell membrane0.034

Rank 5 · TkA07G123100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14658EF-hand_9135-156 aa

PF29176Allatotropin-like_C158-167 aa

PF23564EF-hand_FSTL1199-223 aa

PF10591SPARC_Ca_bdg199-219 aa

PF00036EF-hand_1200-223 aa

PF13405EF-hand_6200-219 aa

PF13499EF-hand_7200-221 aa

PF30624EF_SSP120200-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G123100	`PF14658`	EF-hand_9	135	156	0.031	15.4
TkA07G123100	`PF29176`	Allatotropin-like_C	158	167	0.00049	20.3
TkA07G123100	`PF23564`	EF-hand_FSTL1	199	223	3.9e-05	24.7
TkA07G123100	`PF10591`	SPARC_Ca_bdg	199	219	0.12	13.4
TkA07G123100	`PF00036`	EF-hand_1	200	223	2.9e-19	67.8
TkA07G123100	`PF13405`	EF-hand_6	200	219	6.5e-17	60.3
TkA07G123100	`PF13499`	EF-hand_7	200	221	2.7e-14	54.0
TkA07G123100	`PF30624`	EF_SSP120	200	218	8.1e-05	23.9
TkA07G123100	`PF13202`	EF-hand_5	201	221	6.9e-16	57.6
TkA07G123100	`PF13499`	EF-hand_7	201	256	2.7e-14	54.0
TkA07G123100	`PF24548`	EF_EFCAB10_C	201	218	1.1	9.7
TkA07G123100	`PF13833`	EF-hand_8	202	222	3.6e-16	59.4
TkA07G123100	`PF12763`	EH	202	224	0.00011	22.8
TkA07G123100	`PF14658`	EF-hand_9	202	257	0.031	15.4
TkA07G123100	`PF00404`	Dockerin_1	205	255	0.00023	22.0
TkA07G123100	`PF29176`	Allatotropin-like_C	205	217	0.00049	20.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ45`	Arabidopsis thaliana	sp\|Q9SZ45\|MICU_ARATH Calcium uptake protein, mitochondrial	57.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card