TkA07G121000 | RubberDandelionOmics

Gene overview

TkA07G121000

Reference: TK1151 Chr: Chr07 Coordinates: 31395192-31396517 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · TkA07G121000|TK1151|cDNA

ATGAAAATTGTTTTTCTTGTCCTGATTGCACTTTTGTCATCATCAGCAACATCAAAAGTTACATACGATGTGACACGTTTTGGAGCAAAAGGAGACGGCAAGACAGACTCCACAAAATCCTTTCTCAGCGCTTGGTCTTCAGCATGTAATTTCACAAAGTCCGCCACCATCAACATCCCATCCGGCACCTTCTTGCTTGCAACCGCCATCACATTTGCCGGCGAAAGATGCAAAAGCAGTGCAATCACAATCCGCATCTA...

CDS

Download CDS FASTA

1173 bp · TkA07G121000|TK1151|CDS

ATGAAAATTGTTTTTCTTGTCCTGATTGCACTTTTGTCATCATCAGCAACATCAAAAGTTACATACGATGTGACACGTTTTGGAGCAAAAGGAGACGGCAAGACAGACTCCACAAAATCCTTTCTCAGCGCTTGGTCTTCAGCATGTAATTTCACAAAGTCCGCCACCATCAACATCCCATCCGGCACCTTCTTGCTTGCAACCGCCATCACATTTGCCGGCGAAAGATGCAAAAGCAGTGCAATCACAATCCGCATCTA...

Protein

Download Protein FASTA

390 aa · TkA07G121000|TK1151|PROTEIN

MKIVFLVLIALLSSSATSKVTYDVTRFGAKGDGKTDSTKSFLSAWSSACNFTKSATINIPSGTFLLATAITFAGERCKSSAITIRIYGTLVAPSEYNAIANSGDWIRFHRVNHVTISGGTLDAKGVALWSCKTAGKSCPKGATTLGIYNSQNIVISGLKSVNSQMFHILIDACTNVKLQGVSISASGVSPNTDGIHLISSTYVTILSSKIATGDDCISIGPGNTNLWIEKVACGPGHGISIGSLGWEMEEPGVQNITVST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G121000`
TK1151 ID	TkA07G121000
OH-1004 ID	LXL04_028094
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 95.641 / OH-1004 52.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G121000

Location Chr07:31395192-31396517 (-)

Description Similar to Polygalacturonase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43860`	Probable polygalacturonase At2g43860.	No verified direct reference in this release
`At2g41850`	Polygalacturonase involved in cell separation in the final stages of pod shatter, in anther dehiscence and in floral organ abscission.	Expression of polygalacturonases and evidence to support their role during cell separation processes in Arabidopsis thaliana.2007 · DOI: 10.1093/jxb/erm222 ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768
`At1g02790`	May function in depolymerizing pectin during pollen development, germination, and tube growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028094 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009830 cell wall modification involved in abscission Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009846 pollen germination Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0048868 pollen tube development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT2G41850

ath:AT2G43860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.805

Rank 1 · TkA07G121000 · TK1151

Cytoplasm0.070

Rank 2 · TkA07G121000 · TK1151

Lysosome / Vacuole0.045

Rank 3 · TkA07G121000 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA07G121000 · TK1151

Cell membrane0.041

Rank 5 · TkA07G121000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim23-275 aa

PF00295Glyco_hydro_2849-377 aa

PF05048NosD85-213 aa

PF18889Beta_helix_3114-125 aa

PF13229Beta_helix131-225 aa

PF13229Beta_helix253-383 aa

PF21803Nab2-zf4300-315 aa

PF05048NosD309-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G121000	`PF12708`	Pect-lyase_RHGA_epim	23	275	4.4e-09	37.2
TkA07G121000	`PF00295`	Glyco_hydro_28	49	377	1.4e-83	281.4
TkA07G121000	`PF05048`	NosD	85	213	0.011	16.0
TkA07G121000	`PF18889`	Beta_helix_3	114	125	0.057	14.5
TkA07G121000	`PF13229`	Beta_helix	131	225	0.017	15.4
TkA07G121000	`PF13229`	Beta_helix	253	383	0.017	15.4
TkA07G121000	`PF21803`	Nab2-zf4	300	315	2.1	8.9
TkA07G121000	`PF05048`	NosD	309	366	0.011	16.0
TkA07G121000	`PF12708`	Pect-lyase_RHGA_epim	328	358	4.4e-09	37.2
TkA07G121000	`PF21803`	Nab2-zf4	341	346	2.1	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22818`	Arabidopsis thaliana	sp\|O22818\|PGLR6_ARATH Probable polygalacturonase At2g43860	54.200%	Swiss-Prot	High
`Q8RY29`	Arabidopsis thaliana	sp\|Q8RY29\|ADPG2_ARATH Polygalacturonase ADPG2	42.800%	Swiss-Prot	Medium
`P49062`	Arabidopsis thaliana	sp\|P49062\|PGLR1_ARATH Exopolygalacturonase	40.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card