Gene Card
Gene overview
cDNA / CDS / Protein Sequences
797 bp · TkA07G120830|TK1151|cDNA
TTGATTTCAAATATATCAGGTCGATCAAGAAAAAATTATGATCAAATTAGGTTTAATCTTGATCGATCCAAATCATAATTCCCCAAACTCTTGCCCAATCTTGTTTGGTCATGGATTGGGCAAGAGTTTGGATACAATTAACAAGAATACTAAATTTCATATCCAATGTAGGCGATACTGCCATTCTAATGATGGCAACTCGAATGATAAGAGACAGTGATGAATTAAGACGTCGATCCCTATTAAGAATCCTAGCAAAG...
657 bp · TkA07G120830|TK1151|CDS
ATGGATTGGGCAAGAGTTTGGATACAATTAACAAGAATACTAAATTTCATATCCAATGTAGGCGATACTGCCATTCTAATGATGGCAACTCGAATGATAAGAGACAGTGATGAATTAAGACGTCGATCCCTATTAAGAATCCTAGCAAAGGGATTCTTGATTGTTGATATGCTTCTCACCACGATGTTTATATTTCTTGCCGCATTCGTACTCAACAAAAGTAAACATGAAGTCCCGCAAATGCCCGTTCGGTTGTGGAT...
Protein
Download Protein FASTA218 aa · TkA07G120830|TK1151|PROTEIN
MDWARVWIQLTRILNFISNVGDTAILMMATRMIRDSDELRRRSLLRILAKGFLIVDMLLTTMFIFLAAFVLNKSKHEVPQMPVRLWIVGFTLYCIFHLIFAVIQYKGGPWSQEGFAQFRNMEHKKNIFGILWWGLGMFFMVKGDDQMYLSAPELTWILTFYLWFDIGLAICCMLFFLLIFIMFCGFIPILFAVIYYTRNRQNKQRLQLPPCPWCNCHK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G120830 |
|---|---|
| TK1151 ID | TkA07G120830 |
| OH-1004 ID | LXL04_028092 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G120830 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:31350686-31351547 (-) | |||||||||
| Description | Similar to RIE1: E3 ubiquitin protein ligase RIE1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G12760 ath:AT1G63170 ath:AT2G01735 ath:AT4G11680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12420DUF367142-103 aaPF06143Baculo_11_kDa52-75 aaPF18967PycTM57-105 aaPF27867Membra_charge57-75 aaPF27867Membra_charge87-128 aaPF12420DUF3671160-199 aaPF18967PycTM165-183 aaPF06143Baculo_11_kDa168-202 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G120830 | PF12420 | DUF3671 | 42 | 103 | 0.053 | 13.7 |
| TkA07G120830 | PF06143 | Baculo_11_kDa | 52 | 75 | 0.51 | 10.7 |
| TkA07G120830 | PF18967 | PycTM | 57 | 105 | 0.87 | 10.1 |
| TkA07G120830 | PF27867 | Membra_charge | 57 | 75 | 1.3 | 9.8 |
| TkA07G120830 | PF27867 | Membra_charge | 87 | 128 | 1.3 | 9.8 |
| TkA07G120830 | PF12420 | DUF3671 | 160 | 199 | 0.053 | 13.7 |
| TkA07G120830 | PF18967 | PycTM | 165 | 183 | 0.87 | 10.1 |
| TkA07G120830 | PF06143 | Baculo_11_kDa | 168 | 202 | 0.51 | 10.7 |
| TkA07G120830 | PF27867 | Membra_charge | 173 | 204 | 1.3 | 9.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.