TkA07G115730 | RubberDandelionOmics

Gene overview

TkA07G115730

Reference: TK1151 Chr: Chr07 Coordinates: 30058358-30061459 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2290 bp · TkA07G115730|TK1151|cDNA

CACCCCCATATATGGGCATATATATATCCTATAAACCCTATAACAAAAATAAGCATATGTTCTTCTTCTTCAACAAATTCTCAATTTAGATTAAATGCAATAAAATCTTGGAAAAGATTCAATCAGTATTTACTCTTTTTTGATAAATTCCTTGTGCTTTTCGGTGGAATATCAGAGTCTCTCACTCTCTTGGTGGCTTCTTCTCAAGAGTTGCAAAGATGCCTACTTTGGTTAACTACAGTCGTGATAAAAATCATATG...

CDS

Download CDS FASTA

1869 bp · TkA07G115730|TK1151|CDS

ATGCCTACTTTGGTTAACTACAGTCGTGATAAAAATCATATGGGAGGATCATTATTTTCCATTCTCGATGTTTATAACCGCCCTAGCAAAAGGCCACGAATCAATCACTCATACAGTCTCTTTTCATATACCAAAATCAATTCATCCATCAACATCCTCCCGGATGAATGTCTTTACGAGATCTTCCGGCGGTTATCCCGCAGCCAAGACAGGAGTGTCGCCGCCTGTGTCTCACTCCGGTGGCTTACCCTCATCAGTAA...

Protein

Download Protein FASTA

622 aa · TkA07G115730|TK1151|PROTEIN

MPTLVNYSRDKNHMGGSLFSILDVYNRPSKRPRINHSYSLFSYTKINSSINILPDECLYEIFRRLSRSQDRSVAACVSLRWLTLISNLKPSEIIVSDKVKLNEFPCDDEQGNDGYLTRSLDGKKATDTRLAAIAVGTSARGGLGKLSVRGSDKVTRIGFSAIAQGCPNLKSLSLWNISMIGDESLIEISKCHFLETLDLCHCPSISDTGLISIAKNCPNLSSFTIESCKNVGNESLQALARNCPNLQSVTIKDCINVGDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G115730`
TK1151 ID	TkA07G115730
OH-1004 ID	LXL04_032368
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.800
Protein coverage (%)	TK1151 98.875 / OH-1004 96.965 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G115730

Location Chr07:30058358-30061459 (+)

Description Similar to EBF1: EIN3-binding F-box protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25490`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1
`At5g25350`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT2G25490

ath:AT4G15475

ath:AT5G25350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · TkA07G115730 · TK1151

Cytoplasm0.093

Rank 2 · TkA07G115730 · TK1151

Plastid0.046

Rank 3 · TkA07G115730 · TK1151

Cell membrane0.037

Rank 4 · TkA07G115730 · TK1151

Mitochondrion0.019

Rank 5 · TkA07G115730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like50-86 aa

PF00646F-box52-89 aa

PF24758LRR_At5g5637075-100 aa

PF25372LRR_FBXL15143-342 aa

PF12799LRR_4153-177 aa

PF29594LRR_SKP2159-251 aa

PF27094DUF8346159-189 aa

PF29477COS111_C164-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G115730	`PF12937`	F-box-like	50	86	0.00056	20.3
TkA07G115730	`PF00646`	F-box	52	89	0.0003	21.3
TkA07G115730	`PF24758`	LRR_At5g56370	75	100	0.00037	20.9
TkA07G115730	`PF25372`	LRR_FBXL15	143	342	4.2e-31	108.7
TkA07G115730	`PF12799`	LRR_4	153	177	1.2e-11	45.1
TkA07G115730	`PF29594`	LRR_SKP2	159	251	1.2e-15	58.2
TkA07G115730	`PF27094`	DUF8346	159	189	0.00088	18.6
TkA07G115730	`PF29477`	COS111_C	164	276	0.16	12.4
TkA07G115730	`PF27087`	LRR_TMOD-LMOD	164	188	0.42	10.9
TkA07G115730	`PF13516`	LRR_6	166	174	1e-11	44.6
TkA07G115730	`PF24758`	LRR_At5g56370	166	202	0.00037	20.9
TkA07G115730	`PF23247`	LRR_RPS2	166	229	0.017	15.8
TkA07G115730	`PF12799`	LRR_4	167	208	1.2e-11	45.1
TkA07G115730	`PF23622`	LRR_At1g61320_AtMIF1	167	390	0.00056	20.1
TkA07G115730	`PF24758`	LRR_At5g56370	168	257	0.00037	20.9
TkA07G115730	`PF23598`	LRR_14	187	203	0.082	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKK0`	Arabidopsis thaliana	sp\|Q9SKK0\|EBF1_ARATH EIN3-binding F-box protein 1	46.600%	Swiss-Prot	Medium
`Q708Y0`	Arabidopsis thaliana	sp\|Q708Y0\|EBF2_ARATH EIN3-binding F-box protein 2	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card