TkA07G115520 | RubberDandelionOmics

Gene overview

TkA07G115520

Reference: TK1151 Chr: Chr07 Coordinates: 29964306-29969471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2082 bp · TkA07G115520|TK1151|cDNA

GTGAAGTGAACTTGCGAAGAGAGAGAAAGAGAGAGAGATAGAAAGTTCTTGAATTTTGTTAATTGTTCAAGCACTTTCCATAGAAAGAAAGAAACAATGGATGAGAAGCAGCGTTTGACCGTCGCCGATGCCGTAGACTACAAGGGGTTCCCGGCTGATAGATCCAAAACCGGTGGTTGGGTCCCTGCGGCCCTTATTCTTGGGATTGAAATTTGTGAGAGGCTTTCAACAATGGGAATAGCAGTGAACTTGGTGACATA...

CDS

Download CDS FASTA

1716 bp · TkA07G115520|TK1151|CDS

ATGGATGAGAAGCAGCGTTTGACCGTCGCCGATGCCGTAGACTACAAGGGGTTCCCGGCTGATAGATCCAAAACCGGTGGTTGGGTCCCTGCGGCCCTTATTCTTGGGATTGAAATTTGTGAGAGGCTTTCAACAATGGGAATAGCAGTGAACTTGGTGACATATTTGGGTGGGACCATGCACCTCCCTAGCTCCACTTCAGCCAATGTGGTGACCGATTTTTTAGGCACATCTTTCCTCTTGTGCCTACTTGGTGGCTT...

Protein

Download Protein FASTA

571 aa · TkA07G115520|TK1151|PROTEIN

MDEKQRLTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPSSTSANVVTDFLGTSFLLCLLGGFLADTFLGRFKTIVIFSAIQTLGTGTLALSTKIPSLRPPSCHSNENCIEANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFDEKDEAEKTQMAYFFNRFFFFISLGTLTAVTVLVYIQDEVGRSLAYGICTISMFIAILVIMSGIKRYRYKKSAGSPIVNIFQVLVAALKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G115520`
TK1151 ID	TkA07G115520
OH-1004 ID	LXL04_028042
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G115520

Location Chr07:29964306-29969471 (+)

Description Similar to NPF6.2: Protein NRT1/ PTR FAMILY 6.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26690`	Low-affinity proton-dependent nitrate transporter.	No verified direct reference in this release
`At1g12110`	Dual affinity nitrate transporter.	CHL1 is a dual-affinity nitrate transporter of Arabidopsis involved in multiple phases of nitrate uptake.1999 · DOI: 10.1105/tpc.11.5.865 The nitrate transporter AtNRT1.1 (CHL1) functions in stomatal opening and contributes to drought susceptibility in Arabidopsis.2003 · DOI: 10.1105/tpc.006312 Switching between the two action modes of the dual-affinity nitrate transporter CHL1 by phosphorylation.2003 · DOI: 10.1093/emboj/cdg118 Transcript profiling in the chl1-5 mutant of Arabidopsis reveals a role of the nitrate transporter NRT1.1 in the regulation of another nitrate transporter, NRT2.1.2004 · DOI: 10.1105/tpc.104.024380 The Arabidopsis NRT1.1 transporter participates in the signaling pathway triggering root colonization of nitrate-rich patches.2006 · DOI: 10.1073/pnas.0605275103 A genetic screen for nitrate regulatory mutants captures the nitrate transporter gene NRT1.1.2009 · DOI: 10.1104/pp.109.140434 Nitrate-regulated auxin transport by NRT1.1 defines a mechanism for nutrient sensing in plants.2010 · DOI: 10.1016/j.devcel.2010.05.008 The herbicide sensitivity gene CHL1 of Arabidopsis encodes a nitrate-inducible nitrate transporter.1993 · DOI: 10.1016/0092-8674(93)90399-b The Arabidopsis CHL1 protein plays a major role in high-affinity nitrate uptake.1998 · DOI: 10.1073/pnas.95.25.15134
`At3g21670`	Low-affinity nitrate transporter.	No verified direct reference in this release
`At3g54140`	Peptide transporter.	AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At2g02040`	Peptide transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028042 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010167 response to nitrate Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0015031 protein transport Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0015833 peptide transport Biological Process

GO:0042128 nitrate assimilation Biological Process

KEGG gene cross-reference

ath:AT1G12110

ath:AT2G02040

ath:AT2G26690

ath:AT3G21670

ath:AT3G54140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.774

Rank 1 · TkA07G115520 · TK1151

Cytoplasm0.083

Rank 2 · TkA07G115520 · TK1151

Endoplasmic reticulum0.074

Rank 3 · TkA07G115520 · TK1151

Lysosome / Vacuole0.071

Rank 4 · TkA07G115520 · TK1151

Mitochondrion0.034

Rank 5 · TkA07G115520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854PTR243-64 aa

PF12650DUF378480-104 aa

PF00854PTR296-524 aa

PF16954HRG141-153 aa

PF12650DUF3784151-230 aa

PF11683DUF3278174-232 aa

PF10242L_HMGIC_fpl179-237 aa

PF16954HRG190-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G115520	`PF00854`	PTR2	43	64	1.4e-104	350.9
TkA07G115520	`PF12650`	DUF3784	80	104	0.0015	19.4
TkA07G115520	`PF00854`	PTR2	96	524	1.4e-104	350.9
TkA07G115520	`PF16954`	HRG	141	153	0.69	11.0
TkA07G115520	`PF12650`	DUF3784	151	230	0.0015	19.4
TkA07G115520	`PF11683`	DUF3278	174	232	4.9	8.0
TkA07G115520	`PF10242`	L_HMGIC_fpl	179	237	0.22	12.5
TkA07G115520	`PF16954`	HRG	190	205	0.69	11.0
TkA07G115520	`PF15190`	TMEM251	317	370	0.0018	19.1
TkA07G115520	`PF10242`	L_HMGIC_fpl	336	388	0.22	12.5
TkA07G115520	`PF11683`	DUF3278	343	380	4.9	8.0
TkA07G115520	`PF12650`	DUF3784	363	378	0.0015	19.4
TkA07G115520	`PF16954`	HRG	375	385	0.69	11.0
TkA07G115520	`PF16954`	HRG	410	427	0.69	11.0
TkA07G115520	`PF16954`	HRG	489	512	0.69	11.0
TkA07G115520	`PF12650`	DUF3784	490	507	0.0015	19.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZY4`	Arabidopsis thaliana	sp\|Q9SZY4\|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2	73.400%	Swiss-Prot	High
`Q05085`	Arabidopsis thaliana	sp\|Q05085\|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3	53.800%	Swiss-Prot	High
`Q9LVE0`	Arabidopsis thaliana	sp\|Q9LVE0\|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4	49.600%	Swiss-Prot	Medium
`Q9M390`	Arabidopsis thaliana	sp\|Q9M390\|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1	43.200%	Swiss-Prot	Medium
`P46032`	Arabidopsis thaliana	sp\|P46032\|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3	42.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card