TkA07G115210 | RubberDandelionOmics

Gene overview

TkA07G115210

Reference: TK1151 Chr: Chr07 Coordinates: 29870177-29874749 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

772 bp · TkA07G115210|TK1151|cDNA

CCTAGAAGGCCAAACCCTCCCCCCAAAAATTGATAAAAGAAAAATAACCCATTTCAACACTGTGCGTGTTTGTTTCGAGAGTTAGGGTTACGCTTCGTTCTTCGAACAACAATGGAGGAGATTACAGAGGCAGTTCAAAACATAACCATCACGAGCGACAATCATAAGAAGAATCGTATTCAAGTTTCCAACACTAAGAAGCCTCTTTTCTTCTACGTTAATCTGGCTAAGAGGTATATGCAGCAGCATAACGATGTGGA...

CDS

Download CDS FASTA

393 bp · TkA07G115210|TK1151|CDS

ATGGAGGAGATTACAGAGGCAGTTCAAAACATAACCATCACGAGCGACAATCATAAGAAGAATCGTATTCAAGTTTCCAACACTAAGAAGCCTCTTTTCTTCTACGTTAATCTGGCTAAGAGGTATATGCAGCAGCATAACGATGTGGAGCTTTCCGCCCTAGGCATGGCTATTGCCACAGTTGTTACAATTGCAGAAATTCTCAAAAACAGTGGATATGCTGTTGAGAAGAAGATCATGACATCTACTATTGACATGAA...

Protein

Download Protein FASTA

130 aa · TkA07G115210|TK1151|PROTEIN

MEEITEAVQNITITSDNHKKNRIQVSNTKKPLFFYVNLAKRYMQQHNDVELSALGMAIATVVTIAEILKNSGYAVEKKIMTSTIDMKDESRGRPIQKAKIEILLGKTEKFDELMAAAEEERELANGEDQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G115210`
TK1151 ID	TkA07G115210
OH-1004 ID	LXL04_028040
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 96.154 / OH-1004 50.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G115210

Location Chr07:29870177-29874749 (+)

Description Similar to At2g34160: Uncharacterized protein At2g34160

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34160`	Uncharacterized protein At2g34160.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028040 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G34160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA07G115210 · TK1151

Nucleus0.474

Rank 2 · TkA07G115210 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA07G115210 · TK1151

Mitochondrion0.062

Rank 4 · TkA07G115210 · TK1151

Cell membrane0.048

Rank 5 · TkA07G115210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23469KH_122-70 aa

PF01918Alba21-83 aa

PF13862BCCIP37-112 aa

PF12328Rpp2039-92 aa

PF06452CBM9_146-87 aa

PF02566OsmC49-119 aa

PF01918Alba90-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G115210	`PF23469`	KH_12	2	70	0.078	13.9
TkA07G115210	`PF01918`	Alba	21	83	1.5e-12	47.8
TkA07G115210	`PF13862`	BCCIP	37	112	0.034	14.6
TkA07G115210	`PF12328`	Rpp20	39	92	0.0001	22.9
TkA07G115210	`PF06452`	CBM9_1	46	87	0.078	13.6
TkA07G115210	`PF02566`	OsmC	49	119	0.05	14.7
TkA07G115210	`PF01918`	Alba	90	98	1.5e-12	47.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22969`	Arabidopsis thaliana	sp\|O22969\|Y2416_ARATH Uncharacterized protein At2g34160	77.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card