TkA07G114800 | RubberDandelionOmics

Gene overview

TkA07G114800

Reference: TK1151 Chr: Chr07 Coordinates: 29767603-29770591 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1569 bp · TkA07G114800|TK1151|cDNA

CACTGTCCACCTACAGATCAAAGCTTTTTCTGGTATAAAAGTACACAACCTAAAAATGGGTAGCCTAGAACTACACCCATATTCGATCACCGCTACACTTTCCCCTTTTTTCTCCAATAAAATTCCACTCGAAATCCACAATTTTTACAAAAAAACAAATTCAAAACCATGTCAATAAGCCTAAAATCTCCAGTATTTGCAGGCAATCCGATAAAATCCAAAACCCCGAAATCAACGGATCCATTTTCACACACATTAGC...

CDS

Download CDS FASTA

1152 bp · TkA07G114800|TK1151|CDS

ATGTCAATAAGCCTAAAATCTCCAGTATTTGCAGGCAATCCGATAAAATCCAAAACCCCGAAATCAACGGATCCATTTTCACACACATTAGCCTTTGAAACCCTCAAGACTCTCCTTTCAGGGCAAACCCAAATCCAAGAACCATCTTCCCTTACCTTCAAGATCTTGCCTTTTAGAAAAGGGAATCCTTTAGTCGGGTCAACTGGTGATTTGGTCAAGAAATGGCATCTGGGTTGGTTGAGTTTTGTCGAAATTAGAGT...

Protein

Download Protein FASTA

383 aa · TkA07G114800|TK1151|PROTEIN

MSISLKSPVFAGNPIKSKTPKSTDPFSHTLAFETLKTLLSGQTQIQEPSSLTFKILPFRKGNPLVGSTGDLVKKWHLGWLSFVEIRVVLEGSEVTLSEDLVVYLGYEGNVVYWGIDVSEGESLVEKFGSRQLCFVQATTLMVATDWADDDAMGQLAIAGHARALLEWHKTSRFCGSCGEKLVPIEAGRRKQCVNESCKKKIYPRIDPVVIMLVIDKENDRALFSKQTRFVPRMWTCLAGFLEPGESLEEAVKRETWEETG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G114800`
TK1151 ID	TkA07G114800
OH-1004 ID	LXL04_028032
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G114800

Location Chr07:29767603-29770591 (+)

Description Similar to NUDT19: Nudix hydrolase 19, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20070`	mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA.	Molecular characterization of organelle-type Nudix hydrolases in Arabidopsis.2008 · DOI: 10.1104/pp.108.128413

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006402 mRNA catabolic process Biological Process

GO:0006742 NADP+ catabolic process Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0110155 NAD-cap decapping Biological Process

GO:0110156 mRNA methylguanosine-cap decapping Biological Process

GO:1901847 nicotinate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005782 peroxisomal matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G20070

bta:617720

hsa:83594

mmu:67993

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.328

Rank 1 · TkA07G114800 · TK1151

Mitochondrion0.323

Rank 2 · TkA07G114800 · TK1151

Cytoplasm0.283

Rank 3 · TkA07G114800 · TK1151

Nucleus0.119

Rank 4 · TkA07G114800 · TK1151

Plastid0.111

Rank 5 · TkA07G114800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09296NUDIX-like57-167 aa

PF27461TraD_C118-125 aa

PF12773DZR168-199 aa

PF09297Zn_ribbon_NUD170-201 aa

PF103267TM_GPCR_Str200-215 aa

PF00293NUDIX208-319 aa

PF103267TM_GPCR_Str234-286 aa

PF27461TraD_C241-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G114800	`PF09296`	NUDIX-like	57	167	0.00067	21.1
TkA07G114800	`PF27461`	TraD_C	118	125	0.24	11.9
TkA07G114800	`PF12773`	DZR	168	199	0.11	13.4
TkA07G114800	`PF09297`	Zn_ribbon_NUD	170	201	2.1e-07	31.2
TkA07G114800	`PF10326`	7TM_GPCR_Str	200	215	0.083	13.0
TkA07G114800	`PF00293`	NUDIX	208	319	2.4e-16	60.7
TkA07G114800	`PF10326`	7TM_GPCR_Str	234	286	0.083	13.0
TkA07G114800	`PF27461`	TraD_C	241	253	0.24	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A82`	Arabidopsis thaliana	sp\|Q94A82\|NUD19_ARATH Nudix hydrolase 19, chloroplastic	67.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card