TkA07G114410 | RubberDandelionOmics

Gene overview

TkA07G114410

Reference: TK1151 Chr: Chr07 Coordinates: 29676287-29677372 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · TkA07G114410|TK1151|cDNA

ATGATCGGACAAGGAGCTTCAGGATCGGTTTTCAAAGGAAGCTTAAAGGACGGTACTGCCGTCGCCGTCAAGAGAATCCAACATGAAGAGGAACGAGGGGGAAAGGAATTCAGATCTGAAATTTCCGCCATAGCTAGCGTACAGCACGTAAACCTTGTACGCCTGTACGGATACTGCGCTCAGAGTAATAATCTTCATTTTCTCGTGTACGATTTCATTCCCAAAGGCGCTTTATCCAACTGGATTTTCCCCCGCCCTTC...

CDS

Download CDS FASTA

1056 bp · TkA07G114410|TK1151|CDS

ATGATCGGACAAGGAGCTTCAGGATCGGTTTTCAAAGGAAGCTTAAAGGACGGTACTGCCGTCGCCGTCAAGAGAATCCAACATGAAGAGGAACGAGGGGGAAAGGAATTCAGATCTGAAATTTCCGCCATAGCTAGCGTACAGCACGTAAACCTTGTACGCCTGTACGGATACTGCGCTCAGAGTAATAATCTTCATTTTCTCGTGTACGATTTCATTCCCAAAGGCGCTTTATCCAACTGGATTTTCCCCCGCCCTTC...

Protein

Download Protein FASTA

351 aa · TkA07G114410|TK1151|PROTEIN

MIGQGASGSVFKGSLKDGTAVAVKRIQHEEERGGKEFRSEISAIASVQHVNLVRLYGYCAQSNNLHFLVYDFIPKGALSNWIFPRPSSAWQQRLKVGIDVAKALSYLHHDCRSKILHLDVKPENILLDENYNAVVSDFGISKLMNPDDSRVRTSIRGTRGYIAPEWLLGLGASEKSDVFSYGIVLLELIGGRRSVRSIGGDGEGSKRKFEYFPKIVAEKLRAGKIMEVVDQRLLDLGDIDENEVRKMVHVALWCIQHKAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G114410`
TK1151 ID	TkA07G114410
OH-1004 ID	LXL04_028028
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 77.137 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G114410

Location Chr07:29676287-29677372 (+)

Description Similar to At5g20050: Probable receptor-like protein kinase At5g20050

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20050`	Probable receptor-like protein kinase At5g20050.	No verified direct reference in this release
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT4G00340

ath:AT4G32300

ath:AT5G20050

ath:AT5G24080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.705

Rank 1 · TkA07G114410 · TK1151

Cytoplasm0.224

Rank 2 · TkA07G114410 · TK1151

Nucleus0.224

Rank 3 · TkA07G114410 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA07G114410 · TK1151

Golgi apparatus0.028

Rank 5 · TkA07G114410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-270 aa

PF07714PK_Tyr_Ser-Thr2-270 aa

PF01636APH3-108 aa

PF03109ABC18-28 aa

PF17667Pkinase_fungal94-170 aa

PF06734UL9798-142 aa

PF03109ABC1105-148 aa

PF01636APH109-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G114410	`PF00069`	Pkinase	2	270	3.6e-44	151.9
TkA07G114410	`PF07714`	PK_Tyr_Ser-Thr	2	270	4.1e-38	131.9
TkA07G114410	`PF01636`	APH	3	108	0.14	12.6
TkA07G114410	`PF03109`	ABC1	8	28	1.2e-05	25.3
TkA07G114410	`PF17667`	Pkinase_fungal	94	170	0.074	12.5
TkA07G114410	`PF06734`	UL97	98	142	0.016	15.1
TkA07G114410	`PF03109`	ABC1	105	148	1.2e-05	25.3
TkA07G114410	`PF01636`	APH	109	144	0.14	12.6
TkA07G114410	`PF05445`	Pox_ser-thr_kin	109	133	0.16	11.6
TkA07G114410	`PF10140`	YukC	111	148	0.003	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C25`	Arabidopsis thaliana	sp\|Q94C25\|Y5005_ARATH Probable receptor-like protein kinase At5g20050	61.000%	Swiss-Prot	High
`Q8RWZ5`	Arabidopsis thaliana	sp\|Q8RWZ5\|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	45.600%	Swiss-Prot	Medium
`Q39203`	Arabidopsis thaliana	sp\|Q39203\|SD22_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	46.500%	Swiss-Prot	Medium
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	40.700%	Swiss-Prot	Medium
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	42.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card