TkA07G113370 | RubberDandelionOmics

Gene overview

TkA07G113370

Reference: TK1151 Chr: Chr07 Coordinates: 29417841-29422159 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · TkA07G113370|TK1151|cDNA

ATGATGGCCTCGGCGTCAGAGTTAAGTCTTGAATGCAAACCCCACAGCTACTCCATGGCCTTGAAAACGATTGGAGAACAACAACTAAATAACACAAATGATCAAACGCAAAAACTCGAAGAGTTTCTTTCTCGTCTTGAAGAAGAACGACTCAAGATCGATGCTTTTAAGCGTGAACTTCCTCTTTGCATGCAACTCCTCACCAATGCCATGGAGACATCAAGACAACAATTACAAACATACCGTGCTAATCAAGGCTC...

CDS

Download CDS FASTA

1875 bp · TkA07G113370|TK1151|CDS

ATGATGGCCTCGGCGTCAGAGTTAAGTCTTGAATGCAAACCCCACAGCTACTCCATGGCCTTGAAAACGATTGGAGAACAACAACTAAATAACACAAATGATCAAACGCAAAAACTCGAAGAGTTTCTTTCTCGTCTTGAAGAAGAACGACTCAAGATCGATGCTTTTAAGCGTGAACTTCCTCTTTGCATGCAACTCCTCACCAATGCCATGGAGACATCAAGACAACAATTACAAACATACCGTGCTAATCAAGGCTC...

Protein

Download Protein FASTA

624 aa · TkA07G113370|TK1151|PROTEIN

MMASASELSLECKPHSYSMALKTIGEQQLNNTNDQTQKLEEFLSRLEEERLKIDAFKRELPLCMQLLTNAMETSRQQLQTYRANQGSPVLEEFIPLKNLNTEGPEKVSLSSIDNKANWMTSAQLWSQASSTITTAMDNNNNHLKTAQNSTQTDIDFNTKQRNGGAFIPFSKEGNSSCATPGLVLPELALSSGDKDVDHEDNKSCLRENNTSIKGGNINGDVSDTQTTTTATGSGANSSQTHRKTRRCWSPDLHRRFVNAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G113370`
TK1151 ID	TkA07G113370
OH-1004 ID	LXL04_028018
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.500
Protein coverage (%)	TK1151 78.205 / OH-1004 98.138 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G113370

Location Chr07:29417841-29422159 (+)

Description Similar to EFM: Myb family transcription factor EFM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03500`	Transcription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature.	No verified direct reference in this release
`At1g68670`	Probable transcription factor involved in phosphate homeostasis.	Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.2016 · DOI: 10.1093/pcp/pcw063
`At1g25550`	Probable transcription factor involved in phosphate signaling in roots.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0176700`	Probable transcription factor that may play a role in regulatory networks controlling development and metabolism.	No verified direct reference in this release
`Os02g0325600`	Transcriptional repressor that may play a role in response to nitrogen.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

KEGG gene cross-reference

ath:AT1G25550

ath:AT1G68670

ath:AT2G03500

dosa:Os01g0176700

dosa:Os02g0325600

osa:4326224

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · TkA07G113370 · TK1151

Cytoplasm0.154

Rank 2 · TkA07G113370 · TK1151

Cell membrane0.026

Rank 3 · TkA07G113370 · TK1151

Mitochondrion0.018

Rank 4 · TkA07G113370 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA07G113370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28585GH_C3-18 aa

PF26575HHO5_N12-79 aa

PF28585GH_C99-153 aa

PF00830Ribosomal_L28229-255 aa

PF00249Myb_DNA-binding245-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G113370	`PF28585`	GH_C	3	18	0.25	12.6
TkA07G113370	`PF26575`	HHO5_N	12	79	2.2e-27	95.6
TkA07G113370	`PF28585`	GH_C	99	153	0.25	12.6
TkA07G113370	`PF00830`	Ribosomal_L28	229	255	0.0037	18.0
TkA07G113370	`PF00249`	Myb_DNA-binding	245	296	7e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ85`	Arabidopsis thaliana	sp\|Q9ZQ85\|EFM_ARATH Myb family transcription factor EFM	56.300%	Swiss-Prot	Medium
`Q8VZS3`	Arabidopsis thaliana	sp\|Q8VZS3\|HHO2_ARATH Transcription factor HHO2	41.500%	Swiss-Prot	Low
`Q9FPE8`	Arabidopsis thaliana	sp\|Q9FPE8\|HHO3_ARATH Transcription factor HHO3	36.500%	Swiss-Prot	Low
`Q5VRW2`	Oryza sativa subsp. japonica	sp\|Q5VRW2\|NOH1_ORYSJ Transcription factor NIGTH1	47.400%	Swiss-Prot	Medium
`Q6Z869`	Oryza sativa subsp. japonica	sp\|Q6Z869\|NIGT1_ORYSJ Transcription factor NIGT1	38.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card