TkA07G112550 | RubberDandelionOmics

Gene overview

TkA07G112550

Reference: TK1151 Chr: Chr07 Coordinates: 29167122-29167598 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA07G112550|TK1151|cDNA

ATGGCTCCTTTGTTGTCATCATGGGTTCAAGAGAGACATTTCCCCGACCTCCACATCCCCATCTCGATAGACAAGTCCTTCCCAGTCCTTCCCGCAGGATCAATCAAGGCTCGTGATGGGGATACACTTTATCTCTCGAACCTTGATGATATAATCGGAGCTCGAGTTTTCACCCCGACTATTTACTTCTATAATGCAACCAATAGTTCTTTTGATAGTGTTGTTGGCAACTTACGAGATGCCCTAGCTAGGGTTCTAGT...

CDS

Download CDS FASTA

477 bp · TkA07G112550|TK1151|CDS

ATGGCTCCTTTGTTGTCATCATGGGTTCAAGAGAGACATTTCCCCGACCTCCACATCCCCATCTCGATAGACAAGTCCTTCCCAGTCCTTCCCGCAGGATCAATCAAGGCTCGTGATGGGGATACACTTTATCTCTCGAACCTTGATGATATAATCGGAGCTCGAGTTTTCACCCCGACTATTTACTTCTATAATGCAACCAATAGTTCTTTTGATAGTGTTGTTGGCAACTTACGAGATGCCCTAGCTAGGGTTCTAGT...

Protein

Download Protein FASTA

158 aa · TkA07G112550|TK1151|PROTEIN

MAPLLSSWVQERHFPDLHIPISIDKSFPVLPAGSIKARDGDTLYLSNLDDIIGARVFTPTIYFYNATNSSFDSVVGNLRDALARVLVPYYPFSGRLRGTKNGKLEVFFGPNQGVLMVQAHTDLSLDIWVILMFLTQLGLVWCTNSPMKVIIKLLTCLC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G112550`
TK1151 ID	TkA07G112550
OH-1004 ID	LXL04_028011
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 79.747 / OH-1004 27.391 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G112550`
Location	Chr07:29167122-29167598 (+)
Description	Similar to HHT1: Omega-hydroxypalmitate O-feruloyl transferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028011` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006066 alcohol metabolic process Biological Process GO:0009723 response to ethylene Biological Process GO:0009836 fruit ripening, climacteric Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0052325 cell wall pectin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0090431 alkyl caffeate ester biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0009536 plastid Cellular Component GO:0016746 acyltransferase activity Molecular Function GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function GO:0050734 hydroxycinnamoyltransferase activity Molecular Function
KEGG gene cross-reference	ath:AT5G41040 ath:AT5G63560 mdm:103406706 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.343

Rank 1 · TkA07G112550 · TK1151

Nucleus0.238

Rank 2 · TkA07G112550 · TK1151

Endoplasmic reticulum0.215

Rank 3 · TkA07G112550 · TK1151

Cell membrane0.084

Rank 4 · TkA07G112550 · TK1151

Plastid0.077

Rank 5 · TkA07G112550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase27-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G112550	`PF02458`	Transferase	27	125	1.3e-16	61.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card