TkA07G111420 | RubberDandelionOmics

Gene overview

TkA07G111420

Reference: TK1151 Chr: Chr07 Coordinates: 28873385-28876500 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1765 bp · TkA07G111420|TK1151|cDNA

AACCCATTGATCACCTTCTCACCGCTTCACCCACTCTTCCGAAATCGGAAAAGCACTACAATCGGTGACCTAAACTTCCGGTCAGAAATCGATCATCGGATCCCGGCAGTGTTAGTTGTTTCTGTTTCTCCAGTCGACACACCTGATATCACCGATATTCCTGAAGAATTATTCATCGTTGAAATGGTGAAGAATCAACTCATCCCATTTGAATCTGCTGCGAAGGCTTGGTATACTCACAACCAAGCTGGTATTGCACA...

CDS

Download CDS FASTA

621 bp · TkA07G111420|TK1151|CDS

AACCCATTGATCACCTTCTCACCGCTTCACCCACTCTTCCGAAATCGGAAAAGCACTACAATCGGTGACCTAAACTTCCGGTCAGAAATCGATCATCGGATCCCGGCAGTGTTAGTTGTTTCTGTTTCTCCAGTCGACACACCTGATATCACCGATATTCCTGAAGAATTATTCATCGTTGAAATGGTGAAGAATCAACTCATCCCATTTGAATCTGCTGCGAAGGCTTGGTATACTCACAACCAAGCTGGTATTGCACA...

Protein

Download Protein FASTA

206 aa · TkA07G111420|TK1151|PROTEIN

NPLITFSPLHPLFRNRKSTTIGDLNFRSEIDHRIPAVLVVSVSPVDTPDITDIPEELFIVEMVKNQLIPFESAAKAWYTHNQAGIAHGGGIPPLLKLLDSRNGLLQHNAAFALNGLPNNEVDNVANLIRVGGVQKLQDGEFIVQPTRDCLAKTLKMIEEKIHGRVLRYLLYLMRIAERSVQRRVVLAVALSLASVHLMTRKQYSLM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G111420`
TK1151 ID	TkA07G111420
OH-1004 ID	LXL04_001052
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.700
Protein coverage (%)	TK1151 27.670 / OH-1004 8.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G111420

Location Chr07:28873385-28876500 (-)

Description Similar to ARIA: ARM REPEAT PROTEIN INTERACTING WITH ABF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19330`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	ARIA, an Arabidopsis arm repeat protein interacting with a transcriptional regulator of abscisic acid-responsive gene expression, is a novel abscisic acid signaling component.2004 · DOI: 10.1104/pp.104.049189
`At5g13060`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	ABAP1 is a novel plant Armadillo BTB protein involved in DNA replication and transcription.2008 · DOI: 10.1038/emboj.2008.191

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001052 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000011 vacuole inheritance Biological Process

GO:0000045 autophagosome assembly Biological Process

GO:0000425 pexophagy Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034517 ribophagy Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

KEGG gene cross-reference

aor:AO090113000014

ath:AT5G13060

ath:AT5G19330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.430

Rank 1 · TkA07G111420 · TK1151

Cytoplasm0.408

Rank 2 · TkA07G111420 · TK1151

Mitochondrion0.105

Rank 3 · TkA07G111420 · TK1151

Cell membrane0.083

Rank 4 · TkA07G111420 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA07G111420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00514Arm89-110 aa

PF00514Arm122-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G111420	`PF00514`	Arm	89	110	0.0093	16.7
TkA07G111420	`PF00514`	Arm	122	136	0.0093	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DHT4`	Arabidopsis thaliana	sp\|B9DHT4\|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2	77.600%	Swiss-Prot	Low
`B7U179`	Arabidopsis thaliana	sp\|B7U179\|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1	64.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card