Gene Card
Gene overview
cDNA / CDS / Protein Sequences
906 bp · TkA07G111150|TK1151|cDNA
ATGACGGAGATCAAACACCCACTTTTCCCTGTTGTTTCCACACTTCCGTCTTCTCCATCGGGCCATCGACTCCCGTCTCCACCTCCAGCAACCTCTTCCTCCATCAGTTATCTAGGCATGCACACCAACTGTTTGGTAAAATGCCACATAGAAAATATTGAAACAACAACATATGGGGTTAATTCCTATTACATGTCTTCAATTGTAGTTATGGATCACAACCAACAATCAAACACCCCCCCACCAAACCAACAAAATAC...
906 bp · TkA07G111150|TK1151|CDS
ATGACGGAGATCAAACACCCACTTTTCCCTGTTGTTTCCACACTTCCGTCTTCTCCATCGGGCCATCGACTCCCGTCTCCACCTCCAGCAACCTCTTCCTCCATCAGTTATCTAGGCATGCACACCAACTGTTTGGTAAAATGCCACATAGAAAATATTGAAACAACAACATATGGGGTTAATTCCTATTACATGTCTTCAATTGTAGTTATGGATCACAACCAACAATCAAACACCCCCCCACCAAACCAACAAAATAC...
Protein
Download Protein FASTA301 aa · TkA07G111150|TK1151|PROTEIN
MTEIKHPLFPVVSTLPSSPSGHRLPSPPPATSSSISYLGMHTNCLVKCHIENIETTTYGVNSYYMSSIVVMDHNQQSNTPPPNQQNTPPPNQNMAGFGPYSRLLRDGTMSPMIPNQPQFSPMQQSPTIPFNQIHQNINPQNVNIHPQNVYFSQNFNDPRTFLQPEYQQPNFYGGGGSGQATQEEEVVPETQPEPTKRKKRVARKKESSGPAGEKSIDARLAHLASVEEIEKSIDAHLASVEEKKARRDELQAEQQELINQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G111150 |
|---|---|
| TK1151 ID | TkA07G111150 |
| OH-1004 ID | LXL04_037050 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 43.600 |
| Protein coverage (%) | TK1151 65.116 / OH-1004 27.489Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G111150 |
|---|---|
| Location | Chr07:28790615-28791717 (-) |
| Description | Similar to ATG18A: Autophagy-related protein 18a |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0000422 autophagy of mitochondrion Biological Process GO:0000425 pexophagy Biological Process GO:0006914 autophagy Biological Process GO:0006970 response to osmotic stress Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009267 cellular response to starvation Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0010150 leaf senescence Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0015031 protein transport Biological Process |
| KEGG gene cross-reference | ath:AT2G40810 ath:AT3G56440 ath:AT3G62770 ath:AT5G05150 xla:447310 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07767Nop53193-260 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G111150 | PF07767 | Nop53 | 193 | 260 | 0.0059 | 16.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.