TkA07G110570 | RubberDandelionOmics

Gene overview

TkA07G110570

Reference: TK1151 Chr: Chr07 Coordinates: 28633408-28637934 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2432 bp · TkA07G110570|TK1151|cDNA

GCAACTTGTCCTTCCAGCCTTCCCGGCCTGCATTCTTCCTCAATAATTACTTTGGATCGATTGACTTCCGTTTGACCACTGCTCGAGAAATCTACCAAACATGGCAGAGCTTGCAGTGATAATGGAGGTGGGTACTGATGGTGTTGCTGTGATCACCATCTCCAATCCACCTGTCAATGCCTTTGCTGTCTCAATTATTGCTTGGTTGAAGGAGAAAATTGAACAAGCTATGACCAGAGCTGATGTAAAAGCTATCGTTT...

CDS

Download CDS FASTA

2169 bp · TkA07G110570|TK1151|CDS

ATGGCAGAGCTTGCAGTGATAATGGAGGTGGGTACTGATGGTGTTGCTGTGATCACCATCTCCAATCCACCTGTCAATGCCTTTGCTGTCTCAATTATTGCTTGGTTGAAGGAGAAAATTGAACAAGCTATGACCAGAGCTGATGTAAAAGCTATCGTTTTGACTGGCAAGCATAGGAAGTTTTCTGGTGGATTTGACATCAATGTGTTTCAAAATGTTCAGCAGACTGGAAAGTTATCTCTTCTACCTGACTTATCCAT...

Protein

Download Protein FASTA

722 aa · TkA07G110570|TK1151|PROTEIN

MAELAVIMEVGTDGVAVITISNPPVNAFAVSIIAWLKEKIEQAMTRADVKAIVLTGKHRKFSGGFDINVFQNVQQTGKLSLLPDLSIDLVVNKIEDAKKPIVVAIEGLALGAGLEVAMGCHARIATPNAQLGLPELSLGIIPGAGGTQRLPRLLGLPKALDMMLTSKPIISKEGHKLGLIDAIVPPQDLLKVSRQWALDIANNRKPWARSLHLVDKIGSLSEAHEIVKIAREKVKETWPNMPQHLACLDVIMEGIVHGGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G110570`
TK1151 ID	TkA07G110570
OH-1004 ID	LXL04_027979
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G110570

Location Chr07:28633408-28637934 (-)

Description Similar to AIM1: Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29010`	Involved in peroxisomal fatty acid beta-oxidation.	A defect in beta-oxidation causes abnormal inflorescence development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.10.1911 Jasmonate biosynthesis in Arabidopsis thaliana requires peroxisomal beta-oxidation enzymes--additional proof by properties of pex6 and aim1.2007 · DOI: 10.1016/j.phytochem.2007.04.024 The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005
`At3g06860`	Involved in peroxisomal fatty acid beta-oxidation during seed germination.	The Arabidopsis thaliana multifunctional protein gene (MFP2) of peroxisomal beta-oxidation is essential for seedling establishment.2006 · DOI: 10.1111/j.1365-313x.2005.02650.x The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005 Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis .2019 · DOI: 10.1073/pnas.1904143116

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0274100`	Multifunctional enzyme involved in fatty acid beta-oxidation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06860

ath:AT4G29010

bna:106389027

csv:101210295

dosa:Os02g0274100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.595

Rank 1 · TkA07G110570 · TK1151

Cytoplasm0.189

Rank 2 · TkA07G110570 · TK1151

Mitochondrion0.177

Rank 3 · TkA07G110570 · TK1151

Nucleus0.055

Rank 4 · TkA07G110570 · TK1151

Plastid0.055

Rank 5 · TkA07G110570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378ECH_113-208 aa

PF16113ECH_217-196 aa

PF01343Peptidase_S4995-133 aa

PF01343Peptidase_S49208-227 aa

PF16113ECH_2251-268 aa

PF027373HCDH_N310-488 aa

PF03446NAD_binding_2310-383 aa

PF03807F420_oxidored310-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G110570	`PF00378`	ECH_1	13	208	2e-38	132.9
TkA07G110570	`PF16113`	ECH_2	17	196	3.1e-22	80.3
TkA07G110570	`PF01343`	Peptidase_S49	95	133	0.14	12.8
TkA07G110570	`PF01343`	Peptidase_S49	208	227	0.14	12.8
TkA07G110570	`PF16113`	ECH_2	251	268	3.1e-22	80.3
TkA07G110570	`PF02737`	3HCDH_N	310	488	5.6e-58	196.5
TkA07G110570	`PF03446`	NAD_binding_2	310	383	0.07	13.9
TkA07G110570	`PF03807`	F420_oxidored	310	347	0.17	13.2
TkA07G110570	`PF16113`	ECH_2	349	417	3.1e-22	80.3
TkA07G110570	`PF00725`	3HCDH	491	584	1.5e-25	90.3
TkA07G110570	`PF00725`	3HCDH	626	705	1.5e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPI6`	Arabidopsis thaliana	sp\|Q9ZPI6\|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1	67.500%	Swiss-Prot	High
`Q9ZPI5`	Arabidopsis thaliana	sp\|Q9ZPI5\|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2	54.100%	Swiss-Prot	High
`Q8W1L6`	Oryza sativa subsp. japonica	sp\|Q8W1L6\|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein	62.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card