TkA07G106350 | RubberDandelionOmics

Gene overview

TkA07G106350

Reference: TK1151 Chr: Chr07 Coordinates: 27596832-27602186 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2366 bp · TkA07G106350|TK1151|cDNA

TTCTAGTTGGGGGAGTCGGGACCCACAACTTTGTTGATAGCGTGACGGACTCTTCTCTAATCCCACCCTGTCCTTTGAAATATAAATTACGCGGTCTTCACATTTAACCCTTTTCTCTCTCTTTTTATTCTCTCTCTACCATCAGCACCACTGTCCTTTCTTCTTCTTCGATCATGGCGATCTGAGAGAGAAGGGAACACACTATAAATTATTTATTGTTTAGCTATAATTCGAGGCCTTTCTTCGCCTTACACTCTGCC...

CDS

Download CDS FASTA

1569 bp · TkA07G106350|TK1151|CDS

ATGGAGGTTATGTCGCCGTTAGACTCGATTGATTCGTTGTTGTTCTCCGCCAGCAGAGCATTGTGTACTCCTTTCGCCGTATTTGTTCAGATCCAGGGATATGTAATATGCTTACTTTTGGCAGCTGGATGGGCTGGTGCAGCTTATGTAAGAAACAGAGAAATTAGACAGATGAAGAAATGTATGAAAGATGGCAATGACTTTGCGTTTCTTAGTCATGATCTTCACGACCTTGAACACTCAAAACAGATCCAGTTGCC...

Protein

Download Protein FASTA

522 aa · TkA07G106350|TK1151|PROTEIN

MEVMSPLDSIDSLLFSASRALCTPFAVFVQIQGYVICLLLAAGWAGAAYVRNREIRQMKKCMKDGNDFAFLSHDLHDLEHSKQIQLPGVTVVMPLKGFGEHNLHNWRTQLTSLYGGPLEFLFVVDSTEDPAYHAVSRLLLDFKDDVDARIIIAGPSTTCSQKIHNQLVGVEKMHKGSKYVLFLDDDVRLHPGSVGALTAEMEKRPEIFIQTGYPLDLPSGSLGSYCIYEYHMPCSMGFATGGRTFFLWGGCMMMHADDFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G106350`
TK1151 ID	TkA07G106350
OH-1004 ID	LXL04_027928
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G106350`
Location	Chr07:27596832-27602186 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027928` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.440

Rank 1 · TkA07G106350 · TK1151

Endoplasmic reticulum0.423

Rank 2 · TkA07G106350 · TK1151

Cytoplasm0.126

Rank 3 · TkA07G106350 · TK1151

Cell membrane0.115

Rank 4 · TkA07G106350 · TK1151

Nucleus0.096

Rank 5 · TkA07G106350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13506Glyco_transf_2181-203 aa

PF00535Glycos_transf_2110-138 aa

PF00535Glycos_transf_2177-214 aa

PF13632Glyco_trans_2_3179-289 aa

PF13506Glyco_transf_21428-469 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G106350	`PF13506`	Glyco_transf_21	81	203	3.7e-14	53.1
TkA07G106350	`PF00535`	Glycos_transf_2	110	138	0.016	15.9
TkA07G106350	`PF00535`	Glycos_transf_2	177	214	0.016	15.9
TkA07G106350	`PF13632`	Glyco_trans_2_3	179	289	0.0034	17.9
TkA07G106350	`PF13506`	Glyco_transf_21	428	469	3.7e-14	53.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card