TkA07G103490 | RubberDandelionOmics

Gene overview

TkA07G103490

Reference: TK1151 Chr: Chr07 Coordinates: 26926126-26934098 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1570 bp · TkA07G103490|TK1151|cDNA

CGGCAGGTCACGTATCTGTGTCATTCCCGCGTACACAACCTTCCACTAACGACAAACCGGTTTGCCAACAAGAAGTCTATTTTAAATACATTCAGTCCTTCTCCCATTCTAAACCAAATATACAAAATGAAAACCACTCCCTCTACCCTTGTAACCAAAACGTTACAATGCTTATTGTCACTCCACCATATTCTAACATGCGCTTACCACTGGTCTCGAACCACACTCTTTTCATTTCTTCGGGTTGTTTCTCCTTCGCC...

CDS

Download CDS FASTA

642 bp · TkA07G103490|TK1151|CDS

ATGTTAGGGTACTTGGTTTTAGCCAACTTGGAAACTCGAAATCCTACAAATCGCCCAGAAAGCTACGATCTTCTTTTCACCGCCGTCTCAGCTGTGACTGTGTCTAGCATGACCACAGTTGAGATGGAGGTTTTCTCGAATACCCAACTCTTTTGTTTGGCTATTTTGATGCTTTTGGGCGGAGAAGTTTTCACCTCGATGCTTGAACTTCAAGTCCAGAAATTTAAGTTGTTCGAAAAGATCAAAAGACATGCCACCTC...

Protein

Download Protein FASTA

213 aa · TkA07G103490|TK1151|PROTEIN

MLGYLVLANLETRNPTNRPESYDLLFTAVSAVTVSSMTTVEMEVFSNTQLFCLAILMLLGGEVFTSMLELQVQKFKLFEKIKRHATSNAKIENGSVPSNTNVDLKYNSIKFLGVIAFGYFLIVQVSGFLLVSLYVGIVSSAKEVLTHKKLNVQVFSIVTTISTFTNCGFLPTNENMMVFRKNLGLLVILIPLSLLGNTLYPVFPDWCYYFLGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G103490`
TK1151 ID	TkA07G103490
OH-1004 ID	LXL04_027906
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 45.905 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G103490

Location Chr07:26926126-26934098 (-)

Description Similar to HKT1: Sodium transporter HKT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10310`	Sodium transporter protein, which plays a central role in plant tolerance to salt.	The Arabidopsis HKT1 gene homolog mediates inward Na(+) currents in xenopus laevis oocytes and Na(+) uptake in Saccharomyces cerevisiae.2000 · DOI: 10.1104/pp.122.4.1249 AtHKT1 is a salt tolerance determinant that controls Na(+) entry into plant roots.2001 · DOI: 10.1073/pnas.241501798 Glycine residues in potassium channel-like selectivity filters determine potassium selectivity in four-loop-per-subunit HKT transporters from plants.2002 · DOI: 10.1073/pnas.082123799 Altered shoot/root Na+ distribution and bifurcating salt sensitivity in Arabidopsis by genetic disruption of the Na+ transporter AtHKT1.2002 · DOI: 10.1016/s0014-5793(02)03488-9 Functional analysis of AtHKT1 in Arabidopsis shows that Na(+) recirculation by the phloem is crucial for salt tolerance.2003 · DOI: 10.1093/emboj/cdg207 AtHKT1 facilitates Na+ homeostasis and K+ nutrition in planta.2004 · DOI: 10.1104/pp.104.042234 Microarray-based rapid cloning of an ion accumulation deletion mutant in Arabidopsis thaliana.2004 · DOI: 10.1073/pnas.0404780101

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YGP9`	Seems to be involved in regulation of potassium-sodium homeostasis.	No verified direct reference in this release
`Os06g0701700`	Seems to be involved in regulation of potassium-sodium homeostasis.	Two types of HKT transporters with different properties of Na+ and K+ transport in Oryza sativa.2001 · DOI: 10.1046/j.1365-313x.2001.01077.x Glycine residues in potassium channel-like selectivity filters determine potassium selectivity in four-loop-per-subunit HKT transporters from plants.2002 · DOI: 10.1073/pnas.082123799 Sodium transport and HKT transporters: the rice model.2003 · DOI: 10.1046/j.1365-313x.2003.01764.x Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth.2007 · DOI: 10.1038/sj.emboj.7601732 Diversity in expression patterns and functional properties in the rice HKT transporter family.2009 · DOI: 10.1104/pp.109.138008 A role for the OsHKT 2;1 sodium transporter in potassium use efficiency in rice.2020 · DOI: 10.1093/jxb/erz113
`UniProt: Q93XI5`	Seems to be involved in regulation of potassium-sodium homeostasis.	No verified direct reference in this release
`Os04g0607600`	Probable cation transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027906 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008324 monoatomic cation transmembrane transporter activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G10310

dosa:Os02g0175000

dosa:Os06g0701700

osa:4328468

osa:4341971

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.754

Rank 1 · TkA07G103490 · TK1151

Endoplasmic reticulum0.103

Rank 2 · TkA07G103490 · TK1151

Cytoplasm0.101

Rank 3 · TkA07G103490 · TK1151

Lysosome / Vacuole0.061

Rank 4 · TkA07G103490 · TK1151

Mitochondrion0.048

Rank 5 · TkA07G103490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02386TrkH19-203 aa

PF15706TMEM132_C31-59 aa

PF15706TMEM132_C113-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G103490	`PF02386`	TrkH	19	203	1.9e-13	50.5
TkA07G103490	`PF15706`	TMEM132_C	31	59	0.059	13.8
TkA07G103490	`PF15706`	TMEM132_C	113	140	0.059	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TI7`	Arabidopsis thaliana	sp\|Q84TI7\|HKT1_ARATH Sodium transporter HKT1	48.000%	Swiss-Prot	Medium
`A2YGP9`	Oryza sativa subsp. indica	sp\|A2YGP9\|HKT21_ORYSI Cation transporter HKT2;1	41.400%	Swiss-Prot	Medium
`Q0D9S3`	Oryza sativa subsp. japonica	sp\|Q0D9S3\|HKT21_ORYSJ Cation transporter HKT2;1	41.400%	Swiss-Prot	Medium
`Q93XI5`	Oryza sativa subsp. indica	sp\|Q93XI5\|HKT22_ORYSI Cation transporter HKT2;2	40.900%	Swiss-Prot	Medium
`Q7XPF7`	Oryza sativa subsp. japonica	sp\|Q7XPF7\|HKT14_ORYSJ Probable cation transporter HKT1;4	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card