TkA07G101630 | RubberDandelionOmics

Gene overview

TkA07G101630

Reference: TK1151 Chr: Chr07 Coordinates: 26437412-26439931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1908 bp · TkA07G101630|TK1151|cDNA

ATGCTAAACAAGAGATTCAAGATCGCTAAATGCAAGACGTCGTTAAAATTAGCGACATCGAGAATTAAGTTGATGAAGAACAAGAAGATAATACAAATCAATCAAATGAAGAGGGAATTGACTCAATTACTGGACTCCAGCCAGGATCGGACTGCTAGAATTCGAGTTGAACATGTAATCAGGGAAGAGAAGATGATAGCGGCGTATGATTTGATAGAGATATATTGTGAACTTATTGTCGCACGTTTACCTATCATTGA...

CDS

Download CDS FASTA

1908 bp · TkA07G101630|TK1151|CDS

ATGCTAAACAAGAGATTCAAGATCGCTAAATGCAAGACGTCGTTAAAATTAGCGACATCGAGAATTAAGTTGATGAAGAACAAGAAGATAATACAAATCAATCAAATGAAGAGGGAATTGACTCAATTACTGGACTCCAGCCAGGATCGGACTGCTAGAATTCGAGTTGAACATGTAATCAGGGAAGAGAAGATGATAGCGGCGTATGATTTGATAGAGATATATTGTGAACTTATTGTCGCACGTTTACCTATCATTGA...

Protein

Download Protein FASTA

635 aa · TkA07G101630|TK1151|PROTEIN

MLNKRFKIAKCKTSLKLATSRIKLMKNKKIIQINQMKRELTQLLDSSQDRTARIRVEHVIREEKMIAAYDLIEIYCELIVARLPIIESQKTCPIDLKEAITSVIYAAPRCSEIPELVDARKNFTAKYGKEFVSKALELRPDSGVNRMMIEKLSTVAPDLHTKLKKEPVMFEEKLNRRYTLGTHNITSTDTNPSGMASEMMNRRHSFHNNSNSKSSSGKETNWDMGFKDATSAAQAAAESAERASMAARAAAQLSSQGKHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G101630`
TK1151 ID	TkA07G101630
OH-1004 ID	LXL04_027892
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G101630`
Location	Chr07:26437412-26439931 (+)
Description	Similar to DDB_G0289029: IST1-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027892` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008104 intracellular protein localization Biological Process GO:0015031 protein transport Biological Process GO:0036258 multivesicular body assembly Biological Process GO:0045184 establishment of protein localization Biological Process GO:0045862 positive regulation of proteolysis Biological Process GO:0051301 cell division Biological Process GO:0061640 cytoskeleton-dependent cytokinesis Biological Process GO:0061952 midbody abscission Biological Process GO:1904903 ESCRT III complex disassembly Biological Process GO:0000785 chromatin Cellular Component GO:0005576 extracellular region Cellular Component GO:0005635 nuclear envelope Cellular Component
KEGG gene cross-reference	ddi:DDB_G0289029 hsa:9798 mmu:71955 pon:100173540 rno:307833 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.483

Rank 1 · TkA07G101630 · TK1151

Cytoplasm0.310

Rank 2 · TkA07G101630 · TK1151

Nucleus0.278

Rank 3 · TkA07G101630 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA07G101630 · TK1151

Golgi apparatus0.054

Rank 5 · TkA07G101630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03398Ist112-162 aa

PF20822Cmr2_hel_dom123-41 aa

PF20822Cmr2_hel_dom1119-174 aa

PF28394Exg3_C219-239 aa

PF28394Exg3_C304-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G101630	`PF03398`	Ist1	12	162	4.6e-53	180.2
TkA07G101630	`PF20822`	Cmr2_hel_dom1	23	41	0.019	16.2
TkA07G101630	`PF20822`	Cmr2_hel_dom1	119	174	0.019	16.2
TkA07G101630	`PF28394`	Exg3_C	219	239	0.3	12.1
TkA07G101630	`PF28394`	Exg3_C	304	346	0.3	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card