TkA07G101510 | RubberDandelionOmics

Gene overview

TkA07G101510

Reference: TK1151 Chr: Chr07 Coordinates: 26395951-26399482 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1516 bp · TkA07G101510|TK1151|cDNA

ACAAGTGGATGGATTGCACATAAAAACATCGAGCTCCAAAAACCCTAAAACGAGCTCTCAAATCCTCTGCCCCTCTTTTACCCTAAAACCCTAAAAACGAGCTCTAAGGGGCTTTCTCGGGGCGGAACGCAGACACTCAAAACTCAACCATGACCGAAGCTGTGCCATCAAAGGTCAGGTTCGAATACGAAGACGCAGATGAAACCTTAGAAGAAGCAGTCACTGGCAGCTCCAACCTAGAGGAGGATTCCGCCATGTGC...

CDS

Download CDS FASTA

1122 bp · TkA07G101510|TK1151|CDS

ATGACCGAAGCTGTGCCATCAAAGGTCAGGTTCGAATACGAAGACGCAGATGAAACCTTAGAAGAAGCAGTCACTGGCAGCTCCAACCTAGAGGAGGATTCCGCCATGTGCGAGCCCGAGGATTCTTCCGCGGTTGGTGGTGATAAGACCAGCGCTGATTATTACTTCGATTCATACTCTCATTTCGGTAAAAACCAGGAAATGCTGAAGGACGTTGTACGAACCAAGACCTACCAAAATGTCATTTACAAGAACAAGTT...

Protein

Download Protein FASTA

373 aa · TkA07G101510|TK1151|PROTEIN

MTEAVPSKVRFEYEDADETLEEAVTGSSNLEEDSAMCEPEDSSAVGGDKTSADYYFDSYSHFGKNQEMLKDVVRTKTYQNVIYKNKFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADMAQEIVKANGFSDVITVLKGKVEEIDLPVPQVDIIISEWMGYFLLYENMLNTVLYARDKWLVNNGIVLPDNATLHLTAIEDAEYKEDKIEFWNNVYGFDMSCIRKQSMMEPLVDTVDQNQIVTNSQLLKTMNIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G101510`
TK1151 ID	TkA07G101510
OH-1004 ID	LXL04_001829
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.000
Protein coverage (%)	TK1151 46.917 / OH-1004 42.266 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G101510

Location Chr07:26395951-26399482 (-)

Description Similar to PRMT1: Probable protein arginine N-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29510`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in a glycine and arginine-rich domain.	Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana.2007 · DOI: 10.1042/bj20070786 PRMT11: a new Arabidopsis MBD7 protein partner with arginine methyltransferase activity.2007 · DOI: 10.1111/j.1365-313x.2007.03238.x
`At2g19670`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in a glycine and arginine-rich domain.	Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana.2007 · DOI: 10.1042/bj20070786

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z0C0`	Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in target proteins.	No verified direct reference in this release
`Os09g0359800`	Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001829 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0031514 motile cilium Cellular Component

GO:0016274 protein-arginine N-methyltransferase activity Molecular Function

GO:0035241 protein-arginine omega-N monomethyltransferase activity Molecular Function

GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function

GO:0042054 histone methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19670

ath:AT4G29510

cre:CHLRE_03g172550v5

dosa:Os09g0359800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · TkA07G101510 · TK1151

Nucleus0.465

Rank 2 · TkA07G101510 · TK1151

Mitochondrion0.082

Rank 3 · TkA07G101510 · TK1151

Cell membrane0.059

Rank 4 · TkA07G101510 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA07G101510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00398RrnaAD61-133 aa

PF05185PRMT569-169 aa

PF03602Cons_hypoth9571-135 aa

PF01728FtsJ84-132 aa

PF06325PrmA88-164 aa

PF13489Methyltransf_2388-128 aa

PF10294Methyltransf_1689-145 aa

PF05219DREV89-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G101510	`PF00398`	RrnaAD	61	133	0.00016	21.6
TkA07G101510	`PF05185`	PRMT5	69	169	0.0015	19.2
TkA07G101510	`PF03602`	Cons_hypoth95	71	135	0.028	14.8
TkA07G101510	`PF01728`	FtsJ	84	132	0.00033	21.3
TkA07G101510	`PF06325`	PrmA	88	164	5.7e-09	36.6
TkA07G101510	`PF13489`	Methyltransf_23	88	128	0.00034	21.1
TkA07G101510	`PF10294`	Methyltransf_16	89	145	0.02	15.4
TkA07G101510	`PF05219`	DREV	89	133	0.063	13.1
TkA07G101510	`PF13847`	Methyltransf_31	90	164	9.2e-05	23.0
TkA07G101510	`PF02475`	TRM5-TYW2_MTfase	91	174	5.7e-05	23.8
TkA07G101510	`PF05175`	MTS	91	162	0.0002	21.7
TkA07G101510	`PF13679`	Methyltransf_32	91	154	0.13	12.9
TkA07G101510	`PF13649`	Methyltransf_25	94	169	4.6e-09	37.6
TkA07G101510	`PF08241`	Methyltransf_11	95	176	2.6e-07	31.9
TkA07G101510	`PF08242`	Methyltransf_12	95	191	0.0057	18.1
TkA07G101510	`PF13578`	Methyltransf_24	98	151	0.2	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU94`	Arabidopsis thaliana	sp\|Q9SU94\|ANM11_ARATH Protein arginine N-methyltransferase 1.1	76.200%	Swiss-Prot	High
`O82210`	Arabidopsis thaliana	sp\|O82210\|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2	76.900%	Swiss-Prot	High
`A2Z0C0`	Oryza sativa subsp. indica	sp\|A2Z0C0\|ANM1_ORYSI Protein arginine N-methyltransferase 1	76.000%	Swiss-Prot	High
`Q0J2C6`	Oryza sativa subsp. japonica	sp\|Q0J2C6\|ANM1_ORYSJ Protein arginine N-methyltransferase 1	76.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card